Protein Info for QEN71_RS03405 in Paraburkholderia sabiae LMG 24235

Annotation: tetratricopeptide repeat-containing glycosyltransferase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13432: TPR_16
  • amino acids 60 to 112 (53 residues), 24.6 bits, 2.3e-08
  • amino acids 87 to 146 (60 residues), 35.3 bits, 1.1e-11
  • amino acids 119 to 178 (60 residues), 33.8 bits, 3.2e-11
  • amino acids 153 to 213 (61 residues), 30.8 bits, E=2.8e-10
• PF13424: TPR_12
  • amino acids 79 to 143 (65 residues), 45.8 bits, E=4.8e-15
• PF00515: TPR_1
  • amino acids 80 to 112 (33 residues), 29.4 bits, see alignment (E = 4.2e-10)
  • amino acids 115 to 146 (32 residues), 32.4 bits, see alignment (E = 4.9e-11)
• PF07719: TPR_2
  • amino acids 80 to 112 (33 residues), 29.7 bits, see alignment (E = 3.7e-10)
  • amino acids 114 to 146 (33 residues), 30.4 bits, see alignment (E = 2.2e-10)
  • amino acids 182 to 214 (33 residues), 25.6 bits, see alignment (E = 7.6e-09)
• PF07721: TPR_4
  • amino acids 81 to 101 (21 residues), 13.8 bits, see alignment (E = 6.4e-05)
  • amino acids 114 to 135 (22 residues), 14.4 bits, see alignment (E = 4.3e-05)
• PF13176: TPR_7
  • amino acids 81 to 110 (30 residues), 17.1 bits, see alignment (E = 4e-06)
  • amino acids 115 to 146 (32 residues), 23.8 bits, see alignment (E = 2.7e-08)
• PF13181: TPR_8
  • amino acids 81 to 112 (32 residues), 17.4 bits, see alignment (E = 3.4e-06)
  • amino acids 113 to 146 (34 residues), 32.8 bits, see alignment (E = 3.9e-11)
• PF13374: TPR_10
  • amino acids 83 to 108 (26 residues), 16.8 bits, see alignment (E = 4.9e-06)
  • amino acids 113 to 142 (30 residues), 16.6 bits, see alignment (E = 5.6e-06)
• PF13414: TPR_11
  • amino acids 89 to 127 (39 residues), 33.8 bits, 1.8e-11
  • amino acids 120 to 160 (41 residues), 29.6 bits, 3.7e-10
• PF14559: TPR_19
  • amino acids 91 to 147 (57 residues), 36.8 bits, 3.5e-12
• PF13431: TPR_17
  • amino acids 102 to 133 (32 residues), 23.2 bits, see alignment (E = 4.9e-08)
  • amino acids 135 to 167 (33 residues), 25.2 bits, see alignment (E = 1.1e-08)
• PF13174: TPR_6
  • amino acids 115 to 145 (31 residues), 14 bits, see alignment (E = 5.7e-05)
• PF13428: TPR_14
  • amino acids 115 to 154 (40 residues), 25 bits, 1.7e-08

Best Hits

KEGG orthology group: None (inferred from 85% identity to bph:Bphy_0639)

Predicted SEED Role

"FOG: TPR repeat"

Protein Sequence (543 amino acids)

>QEN71_RS03405 tetratricopeptide repeat-containing glycosyltransferase family protein (Paraburkholderia sabiae LMG 24235)
MYGDLQNPEATVDRYSSAVSLYGNARFQEALAMLEPSLIAHTADAQVLNLAAACCLSIDR
PHDAETYWRRAIAVKPDYCDAHSNLGVVLKELGRLDEAAACYHNALAITPNHAGAYVNMG
RLYAQLGRTDEAESAYLRALELQPNDGDFLVNLGVLYQAQMRLPEAEAAYKSAIMANPRD
VKAHFNLGVVLKMQHRFAEAEASYRQTLALQPDYFEVKINLAHLLLNVGRLEEGWALFET
RYDSAWPARKIAPPPVGFPIWRGESLAGKSLLVWPEQGHGDSLQFCRYLPMLKALGLAKL
SVACSPALQSLFETIEGVDRCIVLDGEHDIPQHDYVCLTMSLPQRLGTTTLDAIPRTTPY
LRVPPAYSAKWKGRLPEGNLKVGLVWAGDPRPDQPEINAVDRRRSLDARAYLPLLRVPGI
TFVSLQKGASTQPQIDTLPPELRPFDPMHDVHEFADTAAIIEQLDLVITVDTSIAHLAGA
LNKPTWILSRYDGCWRWLHDRDDTPWYPRARLFRQTQPGEWGEVIERVRTALEEWSTSER
APT