Protein Info for QEN71_RS03365 in Paraburkholderia sabiae LMG 24235

Annotation: trimeric intracellular cation channel family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 206 transmembrane" amino acids 6 to 26 (21 residues), see Phobius details amino acids 33 to 53 (21 residues), see Phobius details amino acids 68 to 87 (20 residues), see Phobius details amino acids 96 to 117 (22 residues), see Phobius details amino acids 123 to 144 (22 residues), see Phobius details amino acids 156 to 175 (20 residues), see Phobius details amino acids 181 to 199 (19 residues), see Phobius details PF03458: Gly_transporter" amino acids 11 to 83 (73 residues), 73.5 bits, see alignment E=5.2e-25 amino acids 99 to 172 (74 residues), 87.1 bits, see alignment E=2.9e-29

Best Hits

Swiss-Prot: 32% identical to Y593_CAMJE: UPF0126 membrane protein Cj0593c (Cj0593c) from Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)

KEGG orthology group: None (inferred from 98% identity to bph:Bphy_0632)

Predicted SEED Role

"Probable transmembrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (206 amino acids)

>QEN71_RS03365 trimeric intracellular cation channel family protein (Paraburkholderia sabiae LMG 24235)
MHPRLTLALSIMEALAILAYAISGFIEARTKRLDAVGTFLVAMATAFGGGTVRDVLLDRR
PFYWVEHQWYAILIFVLSFFAPFVLKAYTRVFNERVLLVADAVGLGLFSISGTSLALDAQ
MPWFVASMMGVATGVFGGIIRDVICNEVPLILRDSRPYATCALVGCWVYLLLDYINFDTV
YSVLIATGFILVARLVTFKLDVRLPH