Protein Info for QEN71_RS03190 in Paraburkholderia sabiae LMG 24235

Annotation: amino acid permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 466 transmembrane" amino acids 23 to 43 (21 residues), see Phobius details amino acids 49 to 66 (18 residues), see Phobius details amino acids 103 to 123 (21 residues), see Phobius details amino acids 129 to 147 (19 residues), see Phobius details amino acids 157 to 179 (23 residues), see Phobius details amino acids 201 to 223 (23 residues), see Phobius details amino acids 244 to 264 (21 residues), see Phobius details amino acids 277 to 303 (27 residues), see Phobius details amino acids 335 to 357 (23 residues), see Phobius details amino acids 364 to 382 (19 residues), see Phobius details amino acids 403 to 425 (23 residues), see Phobius details amino acids 431 to 449 (19 residues), see Phobius details PF00324: AA_permease" amino acids 22 to 457 (436 residues), 430.7 bits, see alignment E=6.9e-133 PF13520: AA_permease_2" amino acids 26 to 435 (410 residues), 130.5 bits, see alignment E=8.4e-42

Best Hits

Swiss-Prot: 72% identical to AROP_SHIFL: Aromatic amino acid transport protein AroP (aroP) from Shigella flexneri

KEGG orthology group: K03293, amino acid transporter, AAT family (inferred from 94% identity to bph:Bphy_0601)

MetaCyc: 72% identical to aromatic amino acid:H+ symporter AroP (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-56; TRANS-RXN-76; TRANS-RXN-77

Predicted SEED Role

"Aromatic amino acid transport protein AroP" in subsystem Aromatic amino acid degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (466 amino acids)

>QEN71_RS03190 amino acid permease (Paraburkholderia sabiae LMG 24235)
MLSDGLNGQQHDGLKRGLKNRHIQLIALGGAIGTGLFLGSAGVLKSAGPSMILGYAIGGF
IAFLIMRQLGEMVAQEPVAGSFSHFAYKYWGDFPGFLSGWNYWMLYVLVSMAELTAVGTY
VHFWWPDVPAWVSALVCFVVINAINLTNVKAYGETEFWFAIIKVVAVIGMILFGGYLLLS
GNGGPQASISNLWSHGGFFPHGFNGLFMMLAVIMFSFGGLELIGITAAEADDPQKSIPKA
VNQVIYRILIFYICSLVVLLSLYPWNQVAEGGSPFVMIFSQIGAGLTANVLNVVVLTAAL
SVYNSGVYANSRMLYGLAEQGNAPRALLKVDKRGVPYMAIGLSALATFACVIINYLIPAK
ALDVLMALVVAALVLNWSLISLTHLKSRRAMLAQGETLVFKSLWFPLGNWLCLAFMAMVL
VILAMTPGLNVSVLLVPVWLFVMWIGYVVKRRRAAAHRLAGATGGR