Protein Info for QEN71_RS03025 in Paraburkholderia sabiae LMG 24235

Annotation: signal peptidase II

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 166 transmembrane" amino acids 13 to 34 (22 residues), see Phobius details amino acids 46 to 67 (22 residues), see Phobius details amino acids 74 to 91 (18 residues), see Phobius details amino acids 100 to 120 (21 residues), see Phobius details amino acids 136 to 156 (21 residues), see Phobius details TIGR00077: signal peptidase II" amino acids 15 to 160 (146 residues), 145.7 bits, see alignment E=6e-47 PF01252: Peptidase_A8" amino acids 19 to 159 (141 residues), 153.6 bits, see alignment E=2e-49

Best Hits

Swiss-Prot: 96% identical to LSPA_PARP8: Lipoprotein signal peptidase (lspA) from Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)

KEGG orthology group: K03101, signal peptidase II [EC: 3.4.23.36] (inferred from 96% identity to bph:Bphy_0573)

MetaCyc: 43% identical to lipoprotein signal peptidase (Escherichia coli K-12 substr. MG1655)
Signal peptidase II. [EC: 3.4.23.36]

Predicted SEED Role

"Lipoprotein signal peptidase (EC 3.4.23.36)" in subsystem Sex pheromones in Enterococcus faecalis and other Firmicutes or Signal peptidase (EC 3.4.23.36)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.4.23.36

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (166 amino acids)

>QEN71_RS03025 signal peptidase II (Paraburkholderia sabiae LMG 24235)
MSRTLSKSTGGSLAPWLGVAVIVILFDQLTKIAVAKVFAYGSSHAIAPFFNLVLVYNRGA
AFSFLAMAGGWQRWAFTALGVAAAILICYLLKRHGNQKMFCTALSLIMGGAIGNVIDRLL
YGHVIDFLDFHVGAWHWPAFNLADSAITVGAALLVFDELRRVRGTR