Protein Info for QEN71_RS02835 in Paraburkholderia sabiae LMG 24235

Annotation: exodeoxyribonuclease VII large subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 459 PF13742: tRNA_anti_2" amino acids 20 to 111 (92 residues), 106 bits, see alignment E=1.4e-34 TIGR00237: exodeoxyribonuclease VII, large subunit" amino acids 21 to 364 (344 residues), 422.9 bits, see alignment E=7.1e-131 PF01336: tRNA_anti-codon" amino acids 39 to 111 (73 residues), 47.8 bits, see alignment E=1.7e-16 PF02601: Exonuc_VII_L" amino acids 135 to 445 (311 residues), 354.2 bits, see alignment E=1.2e-109

Best Hits

Swiss-Prot: 56% identical to EX7L_HERAR: Exodeoxyribonuclease 7 large subunit (xseA) from Herminiimonas arsenicoxydans

KEGG orthology group: K03601, exodeoxyribonuclease VII large subunit [EC: 3.1.11.6] (inferred from 97% identity to bph:Bphy_0539)

Predicted SEED Role

"Exodeoxyribonuclease VII large subunit (EC 3.1.11.6)" in subsystem DNA repair, bacterial (EC 3.1.11.6)

Isozymes

Compare fitness of predicted isozymes for: 3.1.11.6

Use Curated BLAST to search for 3.1.11.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (459 amino acids)

>QEN71_RS02835 exodeoxyribonuclease VII large subunit (Paraburkholderia sabiae LMG 24235)
MNSESQFSSPVGAGGDAVVPVSVLNRAIGTMLERSFPLVWVSGEVSNFTRAASGHWYFSI
KDAQAQMRCVMFRGRAQYAEFTPREGDKIEVRALVTMYEPRGELQLNVEAVRRTGQGRLY
EAFLRLKAQLEGEGLFDPQRKRALPAHPRSIGIVTSLQAAALRDVLTTLARRAPHIPVIV
YPAPVQGAGVSAKLAAMVEAANRRREVDVLIVCRGGGSIEDLWAFNEEVLARAIAASEVP
VVSGVGHETDFTIADFAADVRAPTPTGAAELVSPQRVLLLRDLDHRHATLARGFGRMMER
RAQQLDWLARRLVSPAERLARQRTHLQQLSVRLASAGARPVRDARARFSLVQMRWQRWRP
DLTSHRSKVTGLSERLDRALLRQHERHVARVETLAARLEVLSPQRTLERGYAALLDAQNG
RAVRAPSALKPGRRMTVHLAEGSADIALSDVQPRLTDGF