Protein Info for QEN71_RS02780 in Paraburkholderia sabiae LMG 24235

Annotation: UDP-N-acetylmuramate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00179: UDP-N-acetylenolpyruvoylglucosamine reductase
  • amino acids 15 to 342 (328 residues), 244.8 bits, E=5.4e-77
• PF01565: FAD_binding_4
  • amino acids 31 to 160 (130 residues), 78 bits, E=5.9e-26
• PF02873: MurB_C
  • amino acids 223 to 345 (123 residues), 103.5 bits, E=5.8e-34

Best Hits

Swiss-Prot: 92% identical to MURB_PARP8: UDP-N-acetylenolpyruvoylglucosamine reductase (murB) from Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)

KEGG orthology group: K00075, UDP-N-acetylmuramate dehydrogenase [EC: 1.1.1.158] (inferred from 92% identity to bph:Bphy_0528)

Predicted SEED Role

"UDP-N-acetylenolpyruvoylglucosamine reductase (EC 1.1.1.158)" in subsystem Peptidoglycan Biosynthesis or UDP-N-acetylmuramate from Fructose-6-phosphate Biosynthesis (EC 1.1.1.158)

MetaCyc Pathways

• peptidoglycan biosynthesis I (meso-diaminopimelate containing) (12/12 steps found)
• UDP-N-acetylmuramoyl-pentapeptide biosynthesis I (meso-diaminopimelate containing) (8/8 steps found)
• UDP-N-acetylmuramoyl-pentapeptide biosynthesis II (lysine-containing) (7/8 steps found)
• UDP-N-acetylmuramoyl-pentapeptide biosynthesis III (meso-diaminopimelate containing) (6/8 steps found)
• peptidoglycan biosynthesis III (mycobacteria) (11/15 steps found)
• peptidoglycan recycling I (10/14 steps found)
• peptidoglycan biosynthesis II (staphylococci) (12/17 steps found)
• peptidoglycan biosynthesis IV (Enterococcus faecium) (12/17 steps found)
• peptidoglycan biosynthesis V (β-lactam resistance) (11/17 steps found)

KEGG Metabolic Maps

• Aminosugars metabolism
• Nucleotide sugars metabolism
• Peptidoglycan biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.158

Protein Sequence (346 amino acids)

>QEN71_RS02780 UDP-N-acetylmuramate dehydrogenase (Paraburkholderia sabiae LMG 24235)
MSQSEPLPFIADFPLKPHNTFGFDVRARLACRIESEAQLLAAVRDPRVVGLRRLVLGGGS
NVVLTGDFDGLVLLVALRGRKLVREDNDAWYVEAAAGENWHEFVSWTLAEGMPGLENLAL
IPGTVGAAPIQNIGAYGLEMCERFASLRAVELATGETVEFDADACRFGYRDSVFKQEGRE
RFVIVSVTFRLPKAWVPRAGYGDIARELSAVGLGDATPTPQAIFDAVVAVRRAKLPDPLA
LGNAGSFFKNPVVEAAQFDALLAKEPEIVSYRQPDGRVKLAAGWLIDRCGWKGRALGAAG
VHERQALVLVNRGGATGAEVLALAKAIQQDVAQRFGVELEAEPVCL