Protein Info for QEN71_RS02650 in Paraburkholderia sabiae LMG 24235

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 333 transmembrane" amino acids 34 to 56 (23 residues), see Phobius details amino acids 68 to 92 (25 residues), see Phobius details amino acids 104 to 136 (33 residues), see Phobius details amino acids 141 to 161 (21 residues), see Phobius details amino acids 181 to 201 (21 residues), see Phobius details amino acids 232 to 253 (22 residues), see Phobius details amino acids 260 to 279 (20 residues), see Phobius details amino acids 286 to 304 (19 residues), see Phobius details amino acids 311 to 328 (18 residues), see Phobius details PF02653: BPD_transp_2" amino acids 60 to 324 (265 residues), 156.3 bits, see alignment E=4.5e-50

Best Hits

Swiss-Prot: 53% identical to RBSC_BACSU: Ribose import permease protein RbsC (rbsC) from Bacillus subtilis (strain 168)

KEGG orthology group: K10440, ribose transport system permease protein (inferred from 98% identity to bph:Bphy_0502)

MetaCyc: 48% identical to ribose ABC transporter membrane subunit (Escherichia coli K-12 substr. MG1655)
ABC-28-RXN

Predicted SEED Role

"Xylose ABC transporter, permease protein XylH" in subsystem Xylose utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (333 amino acids)

>QEN71_RS02650 ABC transporter permease (Paraburkholderia sabiae LMG 24235)
MNTPNSSPKTSTVASDTPGAPFRLNWASIKRSTLFYPFIGLLVVCIVMVFASDSFLSAAN
LENVLRQVSINAIIAVGMTAVILTGGIDLSVGSVMALSGTLSAGLMVAGLNGVAAIVIGI
AVGLGFGVANGFFVAFAGMPPIIVTLATMGIARGLALIYTGGYPIDGLPEWVSFFGSGKV
FGIQAPVLIMLVVYAIAWLLLERMPFGRYVYAIGGNEQATRLSGVRVARVKLIVYTLAGL
TSSFAAIVLTSRLMSGQPNAGVGFELDAIAAVVMGGTSISGGRGSIIGTLIGALLLGVLN
NGLNMVGVNPYVQNVIKGGIILLAIYISRERKK