Protein Info for QEN71_RS02545 in Paraburkholderia sabiae LMG 24235

Annotation: nucleobase:cation symporter-2 family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 471 transmembrane" amino acids 21 to 44 (24 residues), see Phobius details amino acids 51 to 78 (28 residues), see Phobius details amino acids 80 to 97 (18 residues), see Phobius details amino acids 103 to 126 (24 residues), see Phobius details amino acids 132 to 157 (26 residues), see Phobius details amino acids 169 to 186 (18 residues), see Phobius details amino acids 192 to 213 (22 residues), see Phobius details amino acids 242 to 265 (24 residues), see Phobius details amino acids 318 to 335 (18 residues), see Phobius details amino acids 344 to 368 (25 residues), see Phobius details amino acids 380 to 400 (21 residues), see Phobius details amino acids 410 to 430 (21 residues), see Phobius details TIGR00801: uracil-xanthine permease" amino acids 12 to 428 (417 residues), 412.8 bits, see alignment E=1.7e-127 PF00860: Xan_ur_permease" amino acids 16 to 397 (382 residues), 382.2 bits, see alignment E=1.2e-118 TIGR03173: xanthine permease" amino acids 21 to 430 (410 residues), 553.2 bits, see alignment E=3.2e-170

Best Hits

Swiss-Prot: 61% identical to UACT_ECOLI: Uric acid transporter UacT (uacT) from Escherichia coli (strain K12)

KEGG orthology group: K03458, nucleobase:cation symporter-2, NCS2 family (inferred from 97% identity to bph:Bphy_0481)

MetaCyc: 61% identical to urate:H+ symporter (Escherichia coli K-12 substr. MG1655)
RXN-5076; TRANS-RXN0-530

Predicted SEED Role

"Xanthine/uracil transporter" in subsystem Purine Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (471 amino acids)

>QEN71_RS02545 nucleobase:cation symporter-2 family protein (Paraburkholderia sabiae LMG 24235)
MHSNTVHPCDERLPFGQLLTLGIQHVLVMYAGAVAVPLIIGSALKLPKEQIAFLISADLF
SCGIATLIQTLGLWIFGIRLPVIMGCTFAAVGPMVAIGTNPSLGILDIFGSTIAAGVIGI
VVAPMIGKLLRFFPPVVVGVVISVIGLSLMEVGINWAAGGVGNPDYGNPVYLGLSLVVLT
LILLINKFGKGFVANISVLLGIVAGFVIAALLGRVNMEGVTNAPWVGFVMPFHFGLPHFD
PLSIATMVTVMFVTFIESTGMFLAVGDMVERPVDQKALVRGLRVDGLGTLIGGIFNSFPH
TSFSQNVGLIGVTGVKSRFVCAMGGVILVLLGLFPKMAQVVASVPAFVLGGAGIVMFGMV
AANGIKVLSKVDFVKNHHNLFIVAVSIGLGLVPVVSPHFFAKLPPALSPLLHSGILLASV
SAVVLNLIFNGVKGERAAKRDIRRAGHDFDGRSGNDDAIAGDEMLRAADMH