Protein Info for QEN71_RS02485 in Paraburkholderia sabiae LMG 24235

Annotation: DegQ family serine endoprotease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 502 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details TIGR02037: peptidase Do" amino acids 56 to 497 (442 residues), 505.1 bits, see alignment E=8.7e-156 PF13365: Trypsin_2" amino acids 132 to 265 (134 residues), 134 bits, see alignment E=2.1e-42 PF00089: Trypsin" amino acids 132 to 289 (158 residues), 70.4 bits, see alignment E=6.3e-23 PF00595: PDZ" amino acids 302 to 369 (68 residues), 48 bits, see alignment E=4e-16 amino acids 415 to 489 (75 residues), 38.4 bits, see alignment E=3.9e-13 PF13180: PDZ_2" amino acids 304 to 394 (91 residues), 63.1 bits, see alignment E=7.1e-21 amino acids 416 to 495 (80 residues), 29.5 bits, see alignment E=2.2e-10 PF17820: PDZ_6" amino acids 331 to 361 (31 residues), 47.9 bits, see alignment (E = 2.7e-16) amino acids 446 to 490 (45 residues), 41.5 bits, see alignment 2.6e-14

Best Hits

KEGG orthology group: K01362, [EC: 3.4.21.-] (inferred from 95% identity to bph:Bphy_0471)

Predicted SEED Role

"HtrA protease/chaperone protein"

Isozymes

Compare fitness of predicted isozymes for: 3.4.21.-

Use Curated BLAST to search for 3.4.21.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (502 amino acids)

>QEN71_RS02485 DegQ family serine endoprotease (Paraburkholderia sabiae LMG 24235)
MKANMLTRSAVAAAVVIALSAGYVAGHRNVPAPQVISPAVAAMMPAEAAAKTGIPDFSGL
VETYGPAVVNISAKHVVKQTAMRGGNNSGQLPIDPSDPFYQFYRHFFGQMPGGPNGGPGG
DDGGDRPSASLGSGFIISQDGYILTNAHVVDGANVVTVKLTDKREYKAKVVGADKQSDVA
VLKIDAKDLPTVKIGDPRASKVGQWVVAIGSPYGFDNTVTSGIISAKSRSLPDENYTPFI
QTDVPVNPGNSGGPLFNLQGEVIGINSMIYSQTGGFQGLSFAIPINEAIKVKDDLVKTGH
VSRGRLGVAVQGVNQTLADSFGMKKPQGALVSSVDPGGPAAKAGLQPGDVILSVNGVDVA
DSSALPSQIAGIKPGTQADLQVWRDKSTKDLKVTIGSLSDTKTAANDEGGPAQMQGRLGV
AVRPLTPQEKSGASVSHGLLVQDASGAAASAGIQPGDVILAVNGRSVSNVDQLKQAVSAA
GNSIALLIQRDNSQIFVPVDLG