Protein Info for QEN71_RS01690 in Paraburkholderia sabiae LMG 24235

Annotation: 50S ribosomal protein L25/general stress protein Ctc

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 203 PF01386: Ribosomal_L25p" amino acids 5 to 89 (85 residues), 85.4 bits, see alignment E=3e-28 TIGR00731: ribosomal protein bL25, Ctc-form" amino acids 7 to 171 (165 residues), 139.5 bits, see alignment E=4.7e-45 PF14693: Ribosomal_TL5_C" amino acids 97 to 181 (85 residues), 79.8 bits, see alignment E=1.5e-26

Best Hits

Swiss-Prot: 97% identical to RL25_PARP8: 50S ribosomal protein L25 (rplY) from Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)

KEGG orthology group: K02897, large subunit ribosomal protein L25 (inferred from 97% identity to bph:Bphy_0314)

Predicted SEED Role

"LSU ribosomal protein L25p" in subsystem Ribosome LSU bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (203 amino acids)

>QEN71_RS01690 50S ribosomal protein L25/general stress protein Ctc (Paraburkholderia sabiae LMG 24235)
MKVIAFERNLQGTGASRRLRNSGKAPGIVYGAGEPQLIEIDHNALWHALKKEAFHSSILD
LEVAGKSQQVLLRDVQYHPFRQIILHVDFQRVDAKKKLHTKVPLHFMNQETNPAVKLGGA
IISHVINEIEIECLPAALPEFIEVDLVKIEAGQSLHATDIVLPAGVALVAHLVAENPVIV
SAPIPAGAQSEEAAAEGEKPAAE