Protein Info for QEN71_RS01585 in Paraburkholderia sabiae LMG 24235

Annotation: N-acetylglucosamine-6-phosphate deacetylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00221: N-acetylglucosamine-6-phosphate deacetylase
  • amino acids 38 to 360 (323 residues), 268 bits, E=6.4e-84
• PF01979: Amidohydro_1
  • amino acids 41 to 354 (314 residues), 63.4 bits, E=2.3e-21

Best Hits

KEGG orthology group: K01443, N-acetylglucosamine-6-phosphate deacetylase [EC: 3.5.1.25] (inferred from 99% identity to bph:Bphy_0293)

Predicted SEED Role

"N-acetylglucosamine-6-phosphate deacetylase (EC 3.5.1.25)" in subsystem Chitin and N-acetylglucosamine utilization or Sialic Acid Metabolism or UDP-N-acetylmuramate from Fructose-6-phosphate Biosynthesis (EC 3.5.1.25)

MetaCyc Pathways

• N-acetylglucosamine degradation II (3/3 steps found)
• N-acetylglucosamine degradation I (2/2 steps found)
• peptidoglycan recycling I (10/14 steps found)
• superpathway of N-acetylneuraminate degradation (15/22 steps found)
• D-galactosamine and N-acetyl-D-galactosamine degradation (1/4 steps found)
• superpathway of N-acetylglucosamine, N-acetylmannosamine and N-acetylneuraminate degradation (2/6 steps found)
• N-acetyl-D-galactosamine degradation (1/5 steps found)
• chitin derivatives degradation (3/8 steps found)

KEGG Metabolic Maps

• Aminosugars metabolism
• Galactose metabolism
• Nucleotide sugars metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.1.25

Protein Sequence (367 amino acids)

>QEN71_RS01585 N-acetylglucosamine-6-phosphate deacetylase (Paraburkholderia sabiae LMG 24235)
MLTGNILTPEGWIHGTIEFENGRVSAIKGDAVDPSTNDAPYILPGFIDLHVHGGGGADVM
EAGNAIEAITRTHARFGTTSLLATTMTAPRDELMAVVAGLGDVAKNRVPGGARVLGVHLE
GPYINPGKLGAQPDAAVSAVLDEVLKYLSIAPIRVVTIAPEISGHMDIISEINARGVRVQ
LGHSLGTYDDAVAAMKHGARSFTHLFNAMSPLHHRNPGMVGAALAHAEYAEIIPDLLHVH
PGAIRAAMRAIPRLYVVTDSTSATGMPDGEYRLGSQHVTKCLGGVRLADGTLAGSTLTMD
QALRNLVSLGLPVADVSNRMSRYAADYLGIEDRGRLARGAWADVVVFDRELALTATYVEG
ESIVEYA