Protein Info for QEN71_RS01485 in Paraburkholderia sabiae LMG 24235

Annotation: methyltransferase domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 321 PF13489: Methyltransf_23" amino acids 36 to 221 (186 residues), 48.9 bits, see alignment E=1.5e-16 PF13847: Methyltransf_31" amino acids 55 to 183 (129 residues), 44.3 bits, see alignment E=4.1e-15 PF13649: Methyltransf_25" amino acids 57 to 167 (111 residues), 51.8 bits, see alignment E=2.7e-17 PF08242: Methyltransf_12" amino acids 58 to 169 (112 residues), 34.5 bits, see alignment E=7.2e-12 PF08241: Methyltransf_11" amino acids 58 to 171 (114 residues), 60 bits, see alignment E=7.2e-20

Best Hits

KEGG orthology group: K02169, biotin synthesis protein BioC (inferred from 97% identity to bph:Bphy_0274)

Predicted SEED Role

"Biotin synthesis protein BioC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (321 amino acids)

>QEN71_RS01485 methyltransferase domain-containing protein (Paraburkholderia sabiae LMG 24235)
MTVSPTETGRPAYDSRRLRKIFDRRAATFDDVAFLPREIAQRMRERLDYIKVNPSQVLDA
GCGAGDDLPSLRERFPEAPVFGTDLSRSMLARAVTHDAADTSWRRFLPASLGKALGARGP
RFAQADFSALPFASGAFEFIWSNLALHWHSRPDLVFPEWQRVLKVNGLLMFSTLGPDTLK
ELRGAYAEIEAAHGVNTHKHVIDFVDMHDLGDMLVESGFEIPVMDQETLTITYKSPESLL
ADVRRWGAYPFRREGLPGVASRRMHKALLAALEARRRGDGTIPLTFEVIYGHAWKAVPRT
TPEGHGIVRIEDIGRGRQGNR