Protein Info for QEN71_RS01265 in Paraburkholderia sabiae LMG 24235

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 379 transmembrane" amino acids 122 to 144 (23 residues), see Phobius details amino acids 169 to 191 (23 residues), see Phobius details amino acids 197 to 213 (17 residues), see Phobius details amino acids 219 to 239 (21 residues), see Phobius details amino acids 261 to 295 (35 residues), see Phobius details amino acids 314 to 338 (25 residues), see Phobius details amino acids 352 to 374 (23 residues), see Phobius details TIGR00056: ABC transport permease subunit" amino acids 133 to 374 (242 residues), 215.5 bits, see alignment E=5.2e-68 PF02405: MlaE" amino acids 163 to 371 (209 residues), 223.7 bits, see alignment E=1.1e-70

Best Hits

KEGG orthology group: K02066, putative ABC transport system permease protein (inferred from 97% identity to bph:Bphy_0205)

Predicted SEED Role

"ABC-type transport system involved in resistance to organic solvents, permease component USSDB6A"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (379 amino acids)

>QEN71_RS01265 ABC transporter permease (Paraburkholderia sabiae LMG 24235)
MNYDTPPGLEVTAGSQGKIVRLSGQWTALALARDRLHGQALPRLRELVDSRSHVAQWDLS
RVERMDHVGGQALWRVWGYKLPRDLVALNDTQRDIFDRIALLDTARESPEAVQRFDPFTK
LGLGIFSFFEHVYGGVAMFGRVILDLLSIARNPKLAPWKEISANVYSAGTQALPITALVA
FLIGIVLSYLSAQQLRLFGANQFIVNILGMSVLRELGPVLSAILVAGRSGSAITAQIGVM
RVTEELDAMRVMGIPHGLRLILPRVIALSLAMPLLVMWTNIISLLGGALAAKIVLQIDVS
YFIRALPGVVPVANLWIGLGKGMVFGMLIAIAGCHFGFRIKANSQSLGEGTTTSVVSSIT
IVILADAVFAILFQNVGLS