Protein Info for QEN71_RS01105 in Paraburkholderia sabiae LMG 24235

Annotation: prolyl oligopeptidase family serine peptidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 429 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details PF02129: Peptidase_S15" amino acids 70 to 208 (139 residues), 41.9 bits, see alignment E=2.1e-14 PF01738: DLH" amino acids 79 to 261 (183 residues), 25.1 bits, see alignment E=2.4e-09 PF00326: Peptidase_S9" amino acids 118 to 222 (105 residues), 39.9 bits, see alignment E=6.7e-14

Best Hits

KEGG orthology group: None (inferred from 93% identity to bph:Bphy_0174)

Predicted SEED Role

"Dienelactone hydrolase and related enzymes"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (429 amino acids)

>QEN71_RS01105 prolyl oligopeptidase family serine peptidase (Paraburkholderia sabiae LMG 24235)
MVFSKVLTVCAMSAAFVASAVTTAHADPLADAETGPLGRAQVQRLALDEDGYLPVVKLSE
QVIRIPVDGDGNVTLETTVYKPEGPGPFPMVVFNHGKIHGDPRMQTRSDPVSLAREFVRR
GYVVVAPNRQGFADSGGSYVQDGCDVTRNGLSQAADVATTVNYMSKQSYVDAQHIVVAGT
SHGGLATIAYGTNAAPGVRALINFSGGLRQDACTDWQGNLTNAFGTYGESTHVPSLWLYG
DNDSIWPSALVSRMYTAYTQNTLGKGVNAKMVDFGSYKNDAHRLVGDRDGVRVWWPSVEA
FLARVGMPTGVQYRVAEPTQPKATHFAKIDAVDSVPFVDEAGRAGYRNFLHQYPSRAFAV
SDSGAWSWAEGGDDPMSVAISNCQKQSSDPCHLYAVNDNVVWKDTSTQTADADAESPSKD
GGKPALASR