Protein Info for QEN71_RS01055 in Paraburkholderia sabiae LMG 24235

Annotation: YbaK/EbsC family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 177 PF04073: tRNA_edit" amino acids 44 to 161 (118 residues), 83.2 bits, see alignment E=8.3e-28

Best Hits

KEGG orthology group: None (inferred from 96% identity to bph:Bphy_0164)

Predicted SEED Role

"Uncharacterized protein SCO3165"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (177 amino acids)

>QEN71_RS01055 YbaK/EbsC family protein (Paraburkholderia sabiae LMG 24235)
MSDNATVQQPSHTPELDALPDSARRVALLLRERGHAGHVVMLPETGKTSAEAAAGLGCSI
AQIAKSILFRRREDDAPVLIIASGANRVDEKKVAAQVGEIARADAKFVREKTGYAIGGVC
PIGHATPPVTLIDADLFTLDSLWAAAGHPHAVFNLTPQELAGLTGAPVVDVALRETA