Protein Info for QEN71_RS01035 in Paraburkholderia sabiae LMG 24235

Annotation: DMT family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 302 transmembrane" amino acids 13 to 32 (20 residues), see Phobius details amino acids 38 to 62 (25 residues), see Phobius details amino acids 72 to 92 (21 residues), see Phobius details amino acids 99 to 121 (23 residues), see Phobius details amino acids 129 to 147 (19 residues), see Phobius details amino acids 157 to 177 (21 residues), see Phobius details amino acids 188 to 205 (18 residues), see Phobius details amino acids 217 to 237 (21 residues), see Phobius details amino acids 246 to 266 (21 residues), see Phobius details amino acids 272 to 292 (21 residues), see Phobius details PF00892: EamA" amino acids 14 to 144 (131 residues), 45.3 bits, see alignment E=5.1e-16 amino acids 160 to 289 (130 residues), 65.5 bits, see alignment E=2.9e-22

Best Hits

KEGG orthology group: None (inferred from 95% identity to bph:Bphy_0160)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (302 amino acids)

>QEN71_RS01035 DMT family transporter (Paraburkholderia sabiae LMG 24235)
MAAGNEVREVRRGAFEMTLAMLMSGTIGWLVVSSQQSALNVAFFRCLFGGATLLLICAAR
GLLKRKLFSWKMIALATLGSAAIVANWVLLFASYSRASISMATTVYSTQPFMLVALGALV
FRERVTASTVVWLLIAFVGLVFVVKVEPAVLAVPGQYLQGVAYAVGAAFLYAVSSIITKH
LKNTPPHLIALITVTTGVVVLAPFVQYDALPSTGTHWLQLVTLGVVNTGIMYVLLYGAIQ
KLPTAMTGALSFIYPVVAIAVDRIAFGQKLAWIQVLGAVLILLAAAGVNLGWRIVPARRY
SI