Protein Info for QEN71_RS00630 in Paraburkholderia sabiae LMG 24235

Annotation: cation diffusion facilitator family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 transmembrane" amino acids 21 to 41 (21 residues), see Phobius details amino acids 47 to 66 (20 residues), see Phobius details amino acids 87 to 108 (22 residues), see Phobius details amino acids 118 to 141 (24 residues), see Phobius details amino acids 164 to 183 (20 residues), see Phobius details amino acids 189 to 207 (19 residues), see Phobius details TIGR01297: cation diffusion facilitator family transporter" amino acids 17 to 296 (280 residues), 209.8 bits, see alignment E=2.6e-66 PF01545: Cation_efflux" amino acids 21 to 213 (193 residues), 158.5 bits, see alignment E=1.9e-50 PF16916: ZT_dimer" amino acids 218 to 295 (78 residues), 71.5 bits, see alignment E=5e-24

Best Hits

KEGG orthology group: None (inferred from 94% identity to bph:Bphy_0117)

Predicted SEED Role

"Cobalt-zinc-cadmium resistance protein CzcD" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (400 amino acids)

>QEN71_RS00630 cation diffusion facilitator family transporter (Paraburkholderia sabiae LMG 24235)
MSSTLAAQSAEKQRVARKSTYVSIGLNTVLMTMQIAIGVFAHSQALVADGVHSLADLISD
FVVLIANRHSAAEPDADHNYGHSRYETVASLFLGGLLISVGVGMLWRAGTRLSDLQHIPA
VHLSALAVAVVVLLSKEGLFRYMLREAQRVRSAMLIANAWHARSDAASSLVVALGILGSI
AGVRLLDPIAAAIVGFMVARMGWTFGWDALQDLSDRALDEADTADLRARIMSTPGVRDVH
ELRTRKMGDFALVDAHILVDPMISVSEGHYIAETARSRVLSDNRVLDALIHVDPENDAIA
RPPVNLPPRAKIAAEVETALAAQGLKAASVNLHYLSTGLDVEVTLQPSRLDALESEVHQL
ERVDLEALKLTLGARRLSVTHAVDVSTAGAELAREPRGDA