Protein Info for QEN71_RS00545 in Paraburkholderia sabiae LMG 24235

Annotation: LacI family DNA-binding transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 PF00356: LacI" amino acids 1 to 45 (45 residues), 52.4 bits, see alignment 7.2e-18 PF00532: Peripla_BP_1" amino acids 80 to 313 (234 residues), 75 bits, see alignment E=1.4e-24 PF13407: Peripla_BP_4" amino acids 81 to 307 (227 residues), 49.7 bits, see alignment E=7.4e-17 PF13377: Peripla_BP_3" amino acids 170 to 334 (165 residues), 126.1 bits, see alignment E=3e-40

Best Hits

KEGG orthology group: K02529, LacI family transcriptional regulator (inferred from 87% identity to bxe:Bxe_A4339)

Predicted SEED Role

"Transcriptional regulator, LacI family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (350 amino acids)

>QEN71_RS00545 LacI family DNA-binding transcriptional regulator (Paraburkholderia sabiae LMG 24235)
MTDIAKLTGVSQSTVSLVLNNATSAKFSEATRNKVLKAAQELGYRLSAREPLPPSSDERN
LIIYLADEISTSPHPVVNIDGARDAAYAHGKLLAVYSTHGNADIEQQVLDAVLTSPTVFG
VIYATVYTRKVALPAALSRVPTVLLNCYTSEGGQSSIVPAEVAGGHVATEFLLRAGHRRI
GYINGEHWQDAAKDRLKGYRTALATADLPFAPELVRDGDWSSGTGFEHTLSLMREPHPPT
AIFCANDLMALGAIEALKQLGYRVPDDVSVLGYDDQEIARHTHPPLSTVVLPNYELGRWA
VETLLQEVHNQAAGAPVRHRMVKLDGPLIERASVREITEAKHTAINIISD