Protein Info for QEN71_RS00535 in Paraburkholderia sabiae LMG 24235

Annotation: sugar ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 525 PF00005: ABC_tran" amino acids 14 to 163 (150 residues), 97.6 bits, see alignment E=1e-31 amino acids 270 to 423 (154 residues), 78.6 bits, see alignment E=7.1e-26

Best Hits

KEGG orthology group: K10441, ribose transport system ATP-binding protein [EC: 3.6.3.17] (inferred from 88% identity to bxe:Bxe_A4341)

Predicted SEED Role

"Ribose ABC transport system, ATP-binding protein RbsA (TC 3.A.1.2.1)" in subsystem D-ribose utilization (TC 3.A.1.2.1)

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.17

Use Curated BLAST to search for 3.6.3.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (525 amino acids)

>QEN71_RS00535 sugar ABC transporter ATP-binding protein (Paraburkholderia sabiae LMG 24235)
MQGIDISFGGVPALRGANLSVAAGEVHALIGQNGAGKSTMIKILTGAYRRSGGSVRFEGR
EIDFRTPKEAREAGISTIYQEINLVPFRSVAENIFLGREPRRFGLIDWREVQKRASALLE
SFGLQIDVRKPAGSYSTAIQQMVALARAVSSDAKMVIMDESTSSLDEREVELLFTVVRKL
RDDGRAVIFVSHRLDELYALCDRVTVMRDGQTVAQSAMKDIDKRQLVTTMLGRTLAAVVQ
DDSAAREANLARRGDKAISARNLSAHPKVSDVSLDVHAGEAVGLAGLLGSGRTETMRLLF
GADAAEKGALSINGENVALKSPQDAIARGLAYLTEDRKAEGIVPDLSVRDNLTLVCLRTL
SKHGVVDVKKQQAIVERFIASLGIKLRSPDQPIRELSGGNQQKVLLARWLAAQPSLLLLD
EPTRGIDVGAKADVAKIVRELRDEGMAVLLSASELEELTAVADRAVVIRDGRTVAELDGA
QMSESAIMDAIAYGSAGTSQLAEAAEVAAHSAHLNDAQEDERHGS