Protein Info for QEN71_RS00515 in Paraburkholderia sabiae LMG 24235

Annotation: ferredoxin--NADP reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00970: FAD_binding_6
  • amino acids 19 to 98 (80 residues), 32.7 bits, E=8.1e-12
• PF00175: NAD_binding_1
  • amino acids 112 to 229 (118 residues), 34.1 bits, E=3.9e-12

Best Hits

Swiss-Prot: 62% identical to FENR_AZOVI: Ferredoxin--NADP reductase (fpr) from Azotobacter vinelandii

KEGG orthology group: K00528, ferredoxin--NADP+ reductase [EC: 1.18.1.2] (inferred from 98% identity to bph:Bphy_0099)

Predicted SEED Role

"Ferredoxin--NADP(+) reductase (EC 1.18.1.2)" in subsystem Biogenesis of cytochrome c oxidases (EC 1.18.1.2)

MetaCyc Pathways

• 1-butanol autotrophic biosynthesis (engineered) (21/27 steps found)
• ethene biosynthesis V (engineered) (19/25 steps found)
• photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (19/26 steps found)
• oxygenic photosynthesis (12/17 steps found)
• NADPH to cytochrome c oxidase via plastocyanin (thylakoid membrane) (2/4 steps found)
• photosynthesis light reactions (1/4 steps found)
• superpathway of photosynthetic hydrogen production (2/6 steps found)

KEGG Metabolic Maps

• Photosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.18.1.2

Protein Sequence (256 amino acids)

>QEN71_RS00515 ferredoxin--NADP reductase (Paraburkholderia sabiae LMG 24235)
MSNLNPQTVLSVHHWTDTLFSFTCTRDASFRFENGQFTMVGLEVDGKPLIRAYSMASANY
EENLEFLSIKVQDGPLTSRLQHLKVGDQVLIGKKPTGTLMADNLLPGKTLWLLSTGTGLA
PFMSIIKDPDVYDRYDRVVLTHTCRFVDELAYKEYITDHLPAHEHLGELIQEKLVYYPTV
TREPFANRGRITDLIETKKLFDDLDLPHFSLENDRVMLCGSPHMLRDTRELLDSLGFQEG
SNNNPGHYVVEKAFVG