Protein Info for QEN71_RS00500 in Paraburkholderia sabiae LMG 24235

Annotation: amino acid permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 465 transmembrane" amino acids 29 to 49 (21 residues), see Phobius details amino acids 57 to 77 (21 residues), see Phobius details amino acids 89 to 110 (22 residues), see Phobius details amino acids 127 to 149 (23 residues), see Phobius details amino acids 156 to 175 (20 residues), see Phobius details amino acids 185 to 205 (21 residues), see Phobius details amino acids 217 to 238 (22 residues), see Phobius details amino acids 254 to 281 (28 residues), see Phobius details amino acids 301 to 324 (24 residues), see Phobius details amino acids 351 to 372 (22 residues), see Phobius details amino acids 378 to 397 (20 residues), see Phobius details amino acids 409 to 429 (21 residues), see Phobius details amino acids 434 to 453 (20 residues), see Phobius details PF13520: AA_permease_2" amino acids 25 to 442 (418 residues), 218.3 bits, see alignment E=2.9e-68 PF00324: AA_permease" amino acids 30 to 432 (403 residues), 132.7 bits, see alignment E=2.4e-42 PF13906: AA_permease_C" amino acids 408 to 458 (51 residues), 64 bits, see alignment 1.7e-21

Best Hits

Swiss-Prot: 67% identical to YHDG_BACSU: Uncharacterized amino acid permease YhdG (yhdG) from Bacillus subtilis (strain 168)

KEGG orthology group: K03294, basic amino acid/polyamine antiporter, APA family (inferred from 96% identity to bph:Bphy_0096)

Predicted SEED Role

"Amino acid transporters"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (465 amino acids)

>QEN71_RS00500 amino acid permease (Paraburkholderia sabiae LMG 24235)
MSLFRKKNVEHMIAGAQAAGLKKALGALDLTFLGVGAIIGTGIFVLTGTGAVQAGPALML
SFIIAAIACGFAALAYAEFASTIPVAGSIYTYSYATLGELAAWIIGWDLMLEYGLATSAV
SVGWSGYLQSLLSGFGVSLPVALTAAPGALPGHETLFNLPAFLVMMAITTLLSVGVREST
RVNNLMVAIKVTVVLLVIVVGVFHVKPENWHPFMPHGFSGVFGAAAVMFFAFIGFDAVSS
AAEEVKNPKRDLPIGIIASLGVCAVLYVAVAAVVTGIVPFGQFANISHPVSYALQVAGQN
WVAGFIDLGAVLGMLTVILVMAYGQTRVIFAMSRDGLLPAGLSKVHPRFATPFATTWIVG
IVFGLIGALVPLNVLAELINIGTLAAFSMVSIAVLVLRRTHPELPRAFRCPGVPVVPVLA
VGSCLFLMVNLSAVTWIAFVVWLVVGMVVYFGYSRKHSKLARPGR