Protein Info for QEN71_RS00395 in Paraburkholderia sabiae LMG 24235

Annotation: L-glyceraldehyde 3-phosphate reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00248: Aldo_ket_red
  • amino acids 28 to 328 (301 residues), 233.5 bits, E=1.4e-73

Best Hits

Swiss-Prot: 66% identical to GPR_ECOLI: L-glyceraldehyde 3-phosphate reductase (gpr) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 99% identity to bph:Bphy_0082)

MetaCyc: 66% identical to L-glyceraldehyde 3-phosphate reductase (Escherichia coli K-12 substr. MG1655)
Aldehyde reductase. [EC: 1.1.1.21]; 1.1.1.- [EC: 1.1.1.21]

Predicted SEED Role

"Oxidoreductase, aldo/keto reductase family"

MetaCyc Pathways

• L-arabinose degradation II (3/3 steps found)
• methylglyoxal degradation III (1/2 steps found)
• superpathway of methylglyoxal degradation (4/8 steps found)
• detoxification of reactive carbonyls in chloroplasts (1/10 steps found)
• superpathway of pentose and pentitol degradation (23/42 steps found)

KEGG Metabolic Maps

• Fructose and mannose metabolism
• Galactose metabolism
• Glycerolipid metabolism
• Pentose and glucuronate interconversions
• Pyruvate metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.21

Protein Sequence (347 amino acids)

>QEN71_RS00395 L-glyceraldehyde 3-phosphate reductase (Paraburkholderia sabiae LMG 24235)
MAYEAASARYSDMQYRVCGKSGLKLPALSLGLWHNFGDTTPISTQREILRTSFDLGITHF
DLANNYGPPYGSAETNFGRIFKDDFRPYRDELLISSKAGWDMWPGPYGQGGGSRKYVLAS
LDQSLQRMGLDYVDIFYSHRFDVDTPLEETAGALASAVQQGKALYIGISSYSAQKTREMA
KLLAEYKVPLLIHQPAYNMLNRWIESELLGALEETGSGAIAFTPLAQGLLTGKYLNGVPQ
DARVNKAGGGSLKQEHLSEQNIERVRKLNVIAERRGQSLAQMALAWTLRDSRVTSALIGA
SKAEQVRENVAALKNLSFTAEELAEIDRYATEGSVNLWEKPSTDQHI