Protein Info for QEN71_RS00285 in Paraburkholderia sabiae LMG 24235

Annotation: methionine biosynthesis protein MetW

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF07021: MetW
  • amino acids 12 to 199 (188 residues), 266.4 bits, E=3.5e-83
• TIGR02081: methionine biosynthesis protein MetW
  • amino acids 12 to 200 (189 residues), 264 bits, E=3.5e-83
• PF13489: Methyltransf_23
  • amino acids 22 to 108 (87 residues), 37.2 bits, E=6.3e-13
• PF13847: Methyltransf_31
  • amino acids 26 to 122 (97 residues), 38.9 bits, E=1.8e-13
• PF13649: Methyltransf_25
  • amino acids 28 to 114 (87 residues), 37.4 bits, E=8.7e-13
• PF08241: Methyltransf_11
  • amino acids 29 to 114 (86 residues), 42.3 bits, E=2.5e-14

Best Hits

KEGG orthology group: None (inferred from 100% identity to bph:Bphy_0060)

Predicted SEED Role

"Homoserine O-acetyltransferase (EC 2.3.1.31)" in subsystem Methionine Biosynthesis (EC 2.3.1.31)

MetaCyc Pathways

• superpathway of L-methionine biosynthesis (by sulfhydrylation) (12/12 steps found)
• L-methionine biosynthesis III (4/4 steps found)
• L-homocysteine biosynthesis (2/2 steps found)
• superpathway of sulfur amino acid biosynthesis (Saccharomyces cerevisiae) (7/10 steps found)
• superpathway of L-cysteine biosynthesis (fungi) (3/6 steps found)

KEGG Metabolic Maps

• Methionine metabolism
• Sulfur metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.31

Use Curated BLAST to search for 2.3.1.31

Protein Sequence (202 amino acids)

>QEN71_RS00285 methionine biosynthesis protein MetW (Paraburkholderia sabiae LMG 24235)
MNQRALDYLATRPDFRAIARWVEPRATVLDLGCGDGSLLSLLSEELEVSGYGIEINDAGV
LASTKNGINVIQQNLEDGLRLFEDGSFDFAILSQTLQTIHQTAAILRETVRVGKECIVSF
PNFGYWAHRLSVLQGRMPVSKSLPYQWHNTPNVRVLTIKDFEALAPEVGIEILDRVVLHG
GQQVRWGVNWRGSLAVYRVKKS