Protein Info for QEN71_RS00280 in Paraburkholderia sabiae LMG 24235

Annotation: AmpG family muropeptide MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 464 transmembrane" amino acids 28 to 51 (24 residues), see Phobius details amino acids 63 to 80 (18 residues), see Phobius details amino acids 100 to 119 (20 residues), see Phobius details amino acids 125 to 146 (22 residues), see Phobius details amino acids 167 to 184 (18 residues), see Phobius details amino acids 190 to 212 (23 residues), see Phobius details amino acids 243 to 269 (27 residues), see Phobius details amino acids 281 to 303 (23 residues), see Phobius details amino acids 310 to 330 (21 residues), see Phobius details amino acids 341 to 364 (24 residues), see Phobius details amino acids 372 to 397 (26 residues), see Phobius details amino acids 409 to 430 (22 residues), see Phobius details amino acids 436 to 458 (23 residues), see Phobius details PF07690: MFS_1" amino acids 33 to 342 (310 residues), 67.9 bits, see alignment E=7.8e-23 PF13000: Acatn" amino acids 35 to 127 (93 residues), 36.1 bits, see alignment E=3e-13

Best Hits

KEGG orthology group: K08218, MFS transporter, PAT family, beta-lactamase induction signal transducer AmpG (inferred from 90% identity to bph:Bphy_0059)

Predicted SEED Role

"AmpG permease"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (464 amino acids)

>QEN71_RS00280 AmpG family muropeptide MFS transporter (Paraburkholderia sabiae LMG 24235)
MSNPPHEAPALTAHEEHPGWRAFLNARMLICVFLGFTSGLPLFTLVYLVQAWLRSEGVNL
KEIGLFALIQFPYTWKFIWAPLMDRYVPRLPGWRPGRRRGWMLATQILVAVAIASLGIVS
PRDSIWTVAALTALVAFFGASQDIVIDAYRRELLHDTEQGLGNAVHVNAYKIAALVPGSL
ALILSDHMPWATVFVVTAAFMLPGMIMTLVVSEPEVHGKPPKNLSEAIIEPFHEFITRDG
WRGALFVLGFIFLYKLGDTMATTLSTSFFLDIGFSRTQIGVIAKTTAFGASLAGGIIGGI
ALMRIGIGRGLWIFGILQMVSTLGFAWLAHVGPTSPGLTVVYDIAVGISAATTKLLSLLG
IGWTVQLDPMSVALAIVYGFETFTTGLTLAAFTAYIASTTDPRYTATQFALFTSLASVPR
TLASAASGFVVAQIGWFDYFIVCTALAIPGMLLLFRIAPWRKQS