Protein Info for QEN71_RS00085 in Paraburkholderia sabiae LMG 24235

Annotation: ABC transporter substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 263 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF00497: SBP_bac_3" amino acids 30 to 256 (227 residues), 197 bits, see alignment E=3.2e-62 PF09084: NMT1" amino acids 104 to 184 (81 residues), 29.3 bits, see alignment E=8.2e-11

Best Hits

Swiss-Prot: 47% identical to HISJ_ECOL6: Histidine-binding periplasmic protein (hisJ) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K10013, lysine/arginine/ornithine transport system substrate-binding protein (inferred from 93% identity to bph:Bphy_0016)

Predicted SEED Role

"Lysine-arginine-ornithine-binding periplasmic protein precursor (TC 3.A.1.3.1)" in subsystem Arginine and Ornithine Degradation (TC 3.A.1.3.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (263 amino acids)

>QEN71_RS00085 ABC transporter substrate-binding protein (Paraburkholderia sabiae LMG 24235)
MKLMKNLLMLACAFASVATTSAMAADATTLRYGLEAQYPPFESKGSNGELQGFDIDVGNA
VCKTANLKCSWVETSFDGLIPALQGRKFDAINSAMNATEKRRQAIDFTNVIYRVPTQLIA
RKDSGLQPTPESLKGKRVGVLQASIQETFAKAHWENAGVTVVPYQDQNQVYTDLVAGRLD
ATLVLAPAGQTGFLSRTDGKDFAFVGQPVRDDKILGSGIAFGIRKGDTALRNQLNAAIAK
VQSDGTVKTLAEKYFGNIDVSAK