Protein Info for Psyr_5095 in Pseudomonas syringae pv. syringae B728a ΔmexB

Annotation: Catalase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

KEGG orthology group: K07217, Mn-containing catalase (inferred from 100% identity to psb:Psyr_5095)

Predicted SEED Role

"Putative catalase (EC 1.11.1.6)" (EC 1.11.1.6)

MetaCyc Pathways

reactive oxygen species degradation (4/4 steps found)
ethanol degradation IV (3/3 steps found)
superoxide radicals degradation (2/2 steps found)
methanol oxidation to formaldehyde IV (1/2 steps found)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.11.1.6

Use Curated BLAST to search for 1.11.1.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZL50 at UniProt or InterPro

Protein Sequence (293 amino acids)

>Psyr_5095 Catalase (Pseudomonas syringae pv. syringae B728a ΔmexB)
MFMYNKRLQYTVRVARPNPGLANLLLEQFGGAQGELAAAGRYFTQGLSEEDPGRKDLLMD
IATEELSHLEIVGSIIVMLNKGAKGQLAEGIEEEGELYRAINGNGNDSHITSLLYGSGAP
LTNSAGVPFTAAYIDTIGEPTADFRSNIAAESRAKIVYERLMNVTDDPGVKEALGFLMTR
EIAHQLSFEKALHAIQPNFPQGKLPGMPEFTNKYFNMSGESNVRGAWNQGGDWEYVESPQ
AAVDGGDGTASVTLNEKDTEALEMMKERTQSDPAANPITGADLGSGLVQGKDA