Protein Info for Psyr_5052 in Pseudomonas syringae pv. syringae B728a ΔmexB

Annotation: Sodium:alanine symporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 483 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 59 to 83 (25 residues), see Phobius details amino acids 90 to 113 (24 residues), see Phobius details amino acids 138 to 156 (19 residues), see Phobius details amino acids 176 to 194 (19 residues), see Phobius details amino acids 203 to 224 (22 residues), see Phobius details amino acids 233 to 255 (23 residues), see Phobius details amino acids 294 to 315 (22 residues), see Phobius details amino acids 338 to 360 (23 residues), see Phobius details amino acids 377 to 393 (17 residues), see Phobius details amino acids 399 to 422 (24 residues), see Phobius details TIGR00835: amino acid carrier protein" amino acids 13 to 432 (420 residues), 481.6 bits, see alignment E=1e-148 PF01235: Na_Ala_symp" amino acids 49 to 445 (397 residues), 507.8 bits, see alignment E=1.4e-156

Best Hits

Swiss-Prot: 46% identical to ALST_BACSU: Amino-acid carrier protein AlsT (alsT) from Bacillus subtilis (strain 168)

KEGG orthology group: K03310, alanine or glycine:cation symporter, AGCS family (inferred from 100% identity to psb:Psyr_5052)

Predicted SEED Role

"sodium/alanine transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZL93 at UniProt or InterPro

Protein Sequence (483 amino acids)

>Psyr_5052 Sodium:alanine symporter (Pseudomonas syringae pv. syringae B728a ΔmexB)
MLEMINDFLSGKVLIVLIVGLGSYFTIRSRFVQFRHFFHMFSVFRDSLRSSAGQLSSFQA
LMLSLAGRVGAGNIAGVGIAVTLGGPGAVFWMWVTALVGMASSFIECSLAQLYKRKDTEG
QFRGGPAFYIQHGLGKRWLGMVMAVLLLVTFGFAFNGLQSHAVTDSLKSAFNVDTRTTGI
CLVVLLGLAFIGGIKRIAAISDLLVPVKTLIYIAVTIYVIVLQIDHVPGMLMTIVRSAFG
LDPVFGGLIGSAIVMGVKRGVFANEAGLGSAPNVAAVAQVEHPVAQGVVQAFSVFLDTFV
ICTCTALLILLSGIYDIGYDGNGIVLAQNSLAAVVGDWGRVFISVALALFVFTSILYNYY
LGENSLRFLFGEKMQTIIIYRIAVLVLIMWGAVVDLKDVLAFADITMTMLAFVNLIALAM
LFKVVKRILNDYDAQRRAGVKTPVFDSSQFPDLDLDRNAWPANPTRQSTQDAEAAAKPAP
EAR