Protein Info for Psyr_5046 in Pseudomonas syringae pv. syringae B728a ΔmexB

Annotation: Transglycosylase-associated protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 81 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details transmembrane" amino acids 27 to 47 (21 residues), see Phobius details amino acids 59 to 78 (20 residues), see Phobius details PF04226: Transgly_assoc" amino acids 33 to 80 (48 residues), 49.4 bits, see alignment E=2.1e-17

Best Hits

Swiss-Prot: 42% identical to YEAQ_ECO57: UPF0410 protein YeaQ (yeaQ) from Escherichia coli O157:H7

KEGG orthology group: None (inferred from 90% identity to pfs:PFLU6053)

Predicted SEED Role

"FIG00953722: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZL99 at UniProt or InterPro

Protein Sequence (81 amino acids)

>Psyr_5046 Transglycosylase-associated protein (Pseudomonas syringae pv. syringae B728a ΔmexB)
MGIIGTIFIGLIVGLLARFLKPGDDSMGWIMTIVLGIAGSLAATYGGQALGLYQAGEGAG
FLGALVGAIILLVIYGMIRKK