Protein Info for Psyr_5033 in Pseudomonas syringae pv. syringae B728a ΔmexB

Annotation: PAS/PAC sensor signal transduction histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 440 signal peptide" amino acids 1 to 36 (36 residues), see Phobius details PF11808: PhoR" amino acids 5 to 90 (86 residues), 95.6 bits, see alignment E=4.8e-31 TIGR02966: phosphate regulon sensor kinase PhoR" amino acids 94 to 425 (332 residues), 453.5 bits, see alignment E=2e-140 PF00989: PAS" amino acids 101 to 151 (51 residues), 30.3 bits, see alignment 9.4e-11 PF00512: HisKA" amino acids 205 to 271 (67 residues), 70.2 bits, see alignment E=3e-23 PF02518: HATPase_c" amino acids 318 to 426 (109 residues), 87.1 bits, see alignment E=2.9e-28

Best Hits

Swiss-Prot: 78% identical to PHOR_PSEAE: Phosphate regulon sensor protein PhoR (phoR) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K07636, two-component system, OmpR family, phosphate regulon sensor histidine kinase PhoR [EC: 2.7.13.3] (inferred from 100% identity to psb:Psyr_5033)

Predicted SEED Role

"Phosphate regulon sensor protein PhoR (SphS) (EC 2.7.13.3)" in subsystem High affinity phosphate transporter and control of PHO regulon or Phosphate metabolism (EC 2.7.13.3)

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZLB2 at UniProt or InterPro

Protein Sequence (440 amino acids)

>Psyr_5033 PAS/PAC sensor signal transduction histidine kinase (Pseudomonas syringae pv. syringae B728a ΔmexB)
MNQNWHGTLIRHMLLLVTACLLVGLISGQYAWSLAAGLGLYLAWTLKQLLRLHEWLSSHK
ADEPPPDGYGLWGEVFDSIYHLQRRDQRVRGRLQAVIDRVQESTAALRDAVIMLDSDGNL
EWWNRAAETLLGLKTPQDSGQPVTNLVRHPRFKEYFALGDYSEPLEIPSPTNDRLRIQLL
ITRYGNNEHLMLVRDVTRIHQLEQMRKDFVANVSHELRTPLTVIFGYLETLLDNVDEVNP
RWVRALQQMHQQGGRMQTLLNDLLLLAKLEATDYPSDNHPVVVNSLLKTITADANALSGS
KNQQIHLSLESDMRLKGSESELRSAFSNLIFNAVKYTPAEGVIRIRWWADERGAHLSVQD
SGIGIETKHLPRLTERFYRVDTSRASNTGGTGLGLAIVKHVLLRHRGNLEINSVLGKGSV
FTCHFASAQLSKPASDDSDY