Protein Info for Psyr_4961 in Pseudomonas syringae pv. syringae B728a ΔmexB

Annotation: conserved hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 237 transmembrane" amino acids 198 to 220 (23 residues), see Phobius details TIGR03349: type IV/VI secretion system protein, DotU family" amino acids 18 to 223 (206 residues), 200.6 bits, see alignment E=1.4e-63 PF09850: DotU" amino acids 19 to 218 (200 residues), 181.4 bits, see alignment E=8.6e-58

Best Hits

KEGG orthology group: K11892, type VI secretion system protein ImpK (inferred from 99% identity to psp:PSPPH_0126)

Predicted SEED Role

"Uncharacterized protein conserved in bacteria"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZLI4 at UniProt or InterPro

Protein Sequence (237 amino acids)

>Psyr_4961 conserved hypothetical protein (Pseudomonas syringae pv. syringae B728a ΔmexB)
MTEAVMQGAATAATEKPTLKDLVRDFITMALIVRRGRQAISVTAFESSVDTFFANLERQA
RSANYSVEQVKDAQYALCAFLDESVLRSGDNDMRRHFEMEPLQFRYFGVHLAGEGFFEKI
ELLRADVKKNLDVLEVYHLCLALGFEGKFGLGQKDQLRYLANTLGQDIARYRKTPKALSP
DWALPDQVSQMLRHEVPVWLYLVLIALVCLGVYLTLDWLLGKDVAALAEQISQLFNA