Protein Info for Psyr_4834 in Pseudomonas syringae pv. syringae B728a ΔmexB

Annotation: histidine:proton symporter, AAT family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 458 transmembrane" amino acids 16 to 36 (21 residues), see Phobius details amino acids 43 to 62 (20 residues), see Phobius details amino acids 87 to 117 (31 residues), see Phobius details amino acids 124 to 143 (20 residues), see Phobius details amino acids 154 to 176 (23 residues), see Phobius details amino acids 200 to 223 (24 residues), see Phobius details amino acids 243 to 263 (21 residues), see Phobius details amino acids 282 to 301 (20 residues), see Phobius details amino acids 332 to 353 (22 residues), see Phobius details amino acids 359 to 380 (22 residues), see Phobius details amino acids 402 to 424 (23 residues), see Phobius details amino acids 430 to 449 (20 residues), see Phobius details PF03845: Spore_permease" amino acids 11 to 298 (288 residues), 32.5 bits, see alignment E=6.3e-12 PF00324: AA_permease" amino acids 15 to 452 (438 residues), 391.2 bits, see alignment E=1e-120 PF13520: AA_permease_2" amino acids 18 to 440 (423 residues), 140.5 bits, see alignment E=1.2e-44

Best Hits

Swiss-Prot: 63% identical to PROY_ECO57: Proline-specific permease ProY (proY) from Escherichia coli O157:H7

KEGG orthology group: K03293, amino acid transporter, AAT family (inferred from 100% identity to psb:Psyr_4834)

MetaCyc: 46% identical to phenylalanine:H+ symporter PheP (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-56

Predicted SEED Role

"Histidine transport protein (permease)" in subsystem Histidine Degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZLW1 at UniProt or InterPro

Protein Sequence (458 amino acids)

>Psyr_4834 histidine:proton symporter, AAT family (Pseudomonas syringae pv. syringae B728a ΔmexB)
MTSQDGLKRGLSARHIRFMALGSAIGTGLFYGSASAIQQAGPAVLLAYLIGGAAVYMVMR
ALGEMAVHDPVSGSFSHYATRYMGPLAGFVLGWTYAFEMIIVCLADVTAFGIYMGFWFPE
VPRWIWVLGIVFLIGALNLCNVKVFGETEFWLSILKVSAIVAMIVAGFGIMIFGIGSSAS
GSEIGISNLWAHGGFMPNGVTGLIASFAVVMFAFGGIEIIGITAGEAKDPRRSLPQAINA
VPLRILLFYVLTLFVLMCIYPWPQIGTQGSPFVQIFDNLGIASAATILNIVVISAAVSAI
NSDIFGAGRMMYGLAREGQAPASFARVSRHGVPWMTVLVMGIALLGGVLLNYLIPKDVFL
LIASLATFATVWVWLMILLTQVSMRRSMSREEAAQLKFAVPFWPYGPAAAIAFMLFIFGV
LGYFPDNRAALIVGAIWIVLLLIAYAVWVKPKALNTTH