Protein Info for Psyr_4818 in Pseudomonas syringae pv. syringae B728a ΔmexB

Annotation: chorismate mutase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 185 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details TIGR01806: putative chorismate mutase" amino acids 27 to 140 (114 residues), 107.3 bits, see alignment E=2.5e-35 PF01817: CM_2" amino acids 33 to 100 (68 residues), 54.2 bits, see alignment E=7.1e-19

Best Hits

Swiss-Prot: 39% identical to CHMU_PSEAE: Monofunctional chorismate mutase (aroQ) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K01850, chorismate mutase [EC: 5.4.99.5] (inferred from 100% identity to psb:Psyr_4818)

Predicted SEED Role

"Periplasmic chorismate mutase I precursor (EC 5.4.99.5)" in subsystem Chorismate Synthesis or Phenylalanine and Tyrosine Branches from Chorismate (EC 5.4.99.5)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 5.4.99.5

Use Curated BLAST to search for 5.4.99.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZLX7 at UniProt or InterPro

Protein Sequence (185 amino acids)

>Psyr_4818 chorismate mutase (Pseudomonas syringae pv. syringae B728a ΔmexB)
MRLILATSLLTMTFMSTCFAFTAEQKPSALEPLLQAISERLTIADQVALSKWDSGKAVED
PPRELQVISAAQARAAEFKLDPDDVQRLFRAQIEANKQVQNALLAQWHAAGKAPDTVRLS
LVDDIRPKLDRLQTQLLQAYADFQPLRKAETCRMQLDAALKRYQTDPIHDQALVLATADL
CPAKL