Protein Info for Psyr_4711 in Pseudomonas syringae pv. syringae B728a ΔmexB

Annotation: Glycine betaine/L-proline transport ATP-binding subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 392 TIGR03415: choline ABC transporter, ATP-binding protein" amino acids 4 to 389 (386 residues), 611.9 bits, see alignment E=2.1e-188 PF00005: ABC_tran" amino acids 44 to 195 (152 residues), 110.2 bits, see alignment E=1.2e-35

Best Hits

KEGG orthology group: K02000, glycine betaine/proline transport system ATP-binding protein [EC: 3.6.3.32] (inferred from 100% identity to psb:Psyr_4711)

Predicted SEED Role

"L-proline glycine betaine ABC transport system permease protein ProV (TC 3.A.1.12.1)" in subsystem Choline and Betaine Uptake and Betaine Biosynthesis (TC 3.A.1.12.1)

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.32

Use Curated BLAST to search for 3.6.3.32

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZM84 at UniProt or InterPro

Protein Sequence (392 amino acids)

>Psyr_4711 Glycine betaine/L-proline transport ATP-binding subunit (Pseudomonas syringae pv. syringae B728a ΔmexB)
MSIIKFDKVDVIFSKDPREALKLLDEGLTRDQILKKTGQIVGVENASLDIEKGEICVLMG
LSGSGKSSLLRCINGLNTVSRGSLFVEHEGSQINIANCSAAELKMMRTKRIAMVFQKFAL
MPWLTVRENISFGLEMQGRPEKERRKLVDEKLELVGLTQWRNKKPDELSGGMQQRVGLAR
ALAMDADILLMDEPFSALDPLIRQGLQDELLALQTKLSKTIVFVSHDLDEALKLGSRIAI
MKDGRIVQYSVPEQIVLNPADEYVRTFVAHTNPLNVLCGRSLMRTVEECTHVNGSVCLDP
SGDSWLDLAEGNVIKGARQGASALDLQNWTPGQDVASLDRRPTLVHSNIGMRDALQIRYQ
TGNKLVLQDGNKVVGILGDTELYHALLGKNHG