Protein Info for Psyr_4695 in Pseudomonas syringae pv. syringae B728a ΔmexB

Annotation: extracellular solute-binding protein, family 1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 333 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF01547: SBP_bac_1" amino acids 36 to 278 (243 residues), 44.4 bits, see alignment E=4.4e-15 PF13416: SBP_bac_8" amino acids 43 to 295 (253 residues), 74.9 bits, see alignment E=1.8e-24 PF13531: SBP_bac_11" amino acids 48 to 283 (236 residues), 59.3 bits, see alignment E=1e-19 PF13343: SBP_bac_6" amino acids 74 to 306 (233 residues), 158 bits, see alignment E=6e-50

Best Hits

KEGG orthology group: K02055, putative spermidine/putrescine transport system substrate-binding protein (inferred from 100% identity to psp:PSPPH_4729)

Predicted SEED Role

"ABC-type Fe3+ transport system, periplasmic component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZMA0 at UniProt or InterPro

Protein Sequence (333 amino acids)

>Psyr_4695 extracellular solute-binding protein, family 1 (Pseudomonas syringae pv. syringae B728a ΔmexB)
MLSLSKTLAALLLCGAASLAQAAETAICYNCPPEWADWGTQLKAIADSTGVQVPLDNKNS
GQALAQIVAEQAAPVADVVYYGVTFGLQAQKAGVVDTYKPKHWDEIPAGLKDPEGHWFAI
HSGTLGIMVNVDALGGLPVPQSWADLLKPEYKGMVGYLDPSSAFVGYVSAVAINQAMGGT
LDNFGPAIDYFQKLAKNSPIVPKQTAYARVLSGELPILVDYDFNAYRARYKDKANVAFVI
PKEGTIGVPYVMSMVAKAPHRANAEKVLDFVLSDEGQALWAKAYLRPVRSKMPAEVAAQF
LPDSDYARAGVVDYQHMAAVQEAFAARYLREVK