Protein Info for Psyr_4686 in Pseudomonas syringae pv. syringae B728a ΔmexB

Annotation: 8-amino-7-oxononanoate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 396 TIGR00858: 8-amino-7-oxononanoate synthase" amino acids 17 to 378 (362 residues), 488.3 bits, see alignment E=5.7e-151 PF00155: Aminotran_1_2" amino acids 39 to 377 (339 residues), 186.8 bits, see alignment E=3.5e-59

Best Hits

Swiss-Prot: 100% identical to BIOF_PSEU2: 8-amino-7-oxononanoate synthase (bioF) from Pseudomonas syringae pv. syringae (strain B728a)

KEGG orthology group: K00652, 8-amino-7-oxononanoate synthase [EC: 2.3.1.47] (inferred from 100% identity to psb:Psyr_4686)

MetaCyc: 38% identical to BioF (Lysinibacillus sphaericus)
8-amino-7-oxononanoate synthase. [EC: 2.3.1.47]

Predicted SEED Role

"8-amino-7-oxononanoate synthase (EC 2.3.1.47)" in subsystem Biotin biosynthesis (EC 2.3.1.47)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.47

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZMA9 at UniProt or InterPro

Protein Sequence (396 amino acids)

>Psyr_4686 8-amino-7-oxononanoate synthase (Pseudomonas syringae pv. syringae B728a ΔmexB)
MSFDLRTRLDARRAAHLYRQRPLLQSPQGPQVIVDGQPLLAFCNNDYMGLANHPEVIAAW
QAGAERWGVGGGASHLVIGHSAPHHELEEALAELTGRPRALLFSNGYMANLGAVTALVGQ
GDTVLEDRLNHASLLDAGLLSGARFSRYLHNDVSSLEARLEKSVGDTLVVTDGVFSMDGD
IADLPALARSAKAKGAWLMVDDAHGFGPLGANGAGIVEHFGLSMDDVPVLVGTLGKSFGT
SGAFVAGSEELIETLIQFARPYIYTTSQPPALACATLKSLQLLRTEHWRREHLTRLIQQF
RRGAEQIGLQLMDSFTPIQPIMIGDAGRALHLSQLLRERGLLVTAIRPPTVPAGSARLRV
TLSAAHSEADVQLLLNTLEQCYPLLDASHSSEPVHA