Protein Info for Psyr_4671 in Pseudomonas syringae pv. syringae B728a ΔmexB

Annotation: coenzyme PQQ synthesis protein B

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 303 TIGR02108: coenzyme PQQ biosynthesis protein B" amino acids 3 to 303 (301 residues), 449 bits, see alignment E=3.8e-139 PF12706: Lactamase_B_2" amino acids 50 to 270 (221 residues), 174.3 bits, see alignment E=1.3e-55

Best Hits

Swiss-Prot: 100% identical to PQQB_PSEU2: Coenzyme PQQ synthesis protein B (pqqB) from Pseudomonas syringae pv. syringae (strain B728a)

KEGG orthology group: K06136, pyrroloquinoline quinone biosynthesis protein B (inferred from 100% identity to psb:Psyr_4671)

Predicted SEED Role

"Coenzyme PQQ synthesis protein B" in subsystem Coenzyme PQQ synthesis or Pyrroloquinoline Quinone biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZMC4 at UniProt or InterPro

Protein Sequence (303 amino acids)

>Psyr_4671 coenzyme PQQ synthesis protein B (Pseudomonas syringae pv. syringae B728a ΔmexB)
MYIQILGSAAGGGFPQWNCNCVNCAGFRDGSLRAHARTQSSIALSDDGINWVLCNASPDI
RAQLQGFAPMQPGRALRDTGISAIVLMDSQIDHTTGLLSLREGCPHQVWCTDMVHEDLST
GFPLFEMLKHWNGGLSWNRIELQGSFVIPACPNLRFTPFPLRSAAPPYSPHRFDPHPGDN
IGLLVEDTRTGGKLFYAPGLGKVDEALAEKMRDADCLLVDGTMWDDDEMQRRGVGTRTGR
EMGHLAQNGPGGMLEVLEGFPEPRKVLIHINNTNPILDEDSPERAELARRNVEVAFDGMS
IEL