Protein Info for Psyr_4669 in Pseudomonas syringae pv. syringae B728a ΔmexB

Annotation: pyrroloquinoline quinone synthesis related protease (pqqF), Metallo peptidase, MEROPS family M16A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 762 TIGR02110: coenzyme PQQ biosynthesis protein PqqF" amino acids 11 to 404 (394 residues), 544.3 bits, see alignment E=3e-167 PF00675: Peptidase_M16" amino acids 20 to 134 (115 residues), 77.6 bits, see alignment E=1.9e-25 PF05193: Peptidase_M16_C" amino acids 180 to 325 (146 residues), 38.1 bits, see alignment E=3.1e-13 amino acids 593 to 678 (86 residues), 26.1 bits, see alignment E=1.5e-09 PF22455: PqqF_C_3" amino acids 414 to 533 (120 residues), 80.3 bits, see alignment E=2.5e-26 PF22456: PqqF-like_C_4" amino acids 606 to 701 (96 residues), 83.5 bits, see alignment E=2e-27

Best Hits

Swiss-Prot: 71% identical to PQQF_PSESM: Coenzyme PQQ synthesis protein F (pqqF) from Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_4669)

Predicted SEED Role

"Coenzyme PQQ synthesis protein F"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZMC6 at UniProt or InterPro

Protein Sequence (762 amino acids)

>Psyr_4669 pyrroloquinoline quinone synthesis related protease (pqqF), Metallo peptidase, MEROPS family M16A (Pseudomonas syringae pv. syringae B728a ΔmexB)
MPAAHSADTQRLTLANGLNVVLCHEPRLKRCAASLRVAAGSHDAPQAWPGLAHFLEHLFF
LGTERFPAGDNLMTFVQRHGGQVNASTRERTTDFFFELPQAAFAQGLQRLCDMLARPRMD
IADQLREREVLHAEFIAWLGDSESRDQARLLTAINPEHPLRGFHAGNRYSLSVPNPAFQQ
ALHDFYRGFYQAGQMTLCLTGPLPMAELQALATNHGAVFATGIKVTQRPPPALMTSPRQA
GEQNHLLFAFEDLPDKADEAVAFFCHWLNAAQPGGLVAELIRRGLCTSLHAAPLYQFGGQ
LLLDIEFKGEPANATAISSLLFSWLGFFEAHWPTRIGEYHRLEQRRLQMCGALALANHHC
RETPAQLSEQGQKALSAFLAKLTADVDNLDPEPVDWRLPAPNPFLGTAADDPAEAALYLR
WQLPSPQPAFWRMLDAALKPLAEDARQAGVTLTFTAYGPYWQLQLNGLREPIVAVLQQSL
LRLQHPDARAQEHDEPVLIPIRQLLKQLADHFLRSNPEVSISDLPSVWAASRWISFTSGF
GPASQSMLDAVLNAAPGVRQTSPADLPTIRAGKHWAAQASSSSEDAVLVFCPAPTTSIED
EAAWRLLAHLAQPPFYQRLRVELQLGYAVFSGLRQIDGKTGLLFGVQSPTCNAQQLFEHI
AAFIGRLPQLVRDADLPEQTNALAAQFEPSNLPEQQRADLQWQAHLAGHQSDHAPTLQRA
LSNLETHSLLASADQLIKATGGWLIVANRPASAAVPQSLPEQ