Protein Info for Psyr_4666 in Pseudomonas syringae pv. syringae B728a ΔmexB

Annotation: transcriptional regulator, AsnC family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 153 PF13404: HTH_AsnC-type" amino acids 9 to 50 (42 residues), 50.5 bits, see alignment E=2.2e-17 PF13412: HTH_24" amino acids 9 to 56 (48 residues), 37.2 bits, see alignment E=2.7e-13 PF01037: AsnC_trans_reg" amino acids 75 to 144 (70 residues), 59.1 bits, see alignment E=4.8e-20

Best Hits

Swiss-Prot: 30% identical to REG6_PYRFU: Uncharacterized HTH-type transcriptional regulator PF1543 (PF1543) from Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)

KEGG orthology group: None (inferred from 99% identity to psp:PSPPH_4700)

Predicted SEED Role

"Transcriptional regulator, AsnC family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZMC9 at UniProt or InterPro

Protein Sequence (153 amino acids)

>Psyr_4666 transcriptional regulator, AsnC family (Pseudomonas syringae pv. syringae B728a ΔmexB)
MPDTRPPVLDEIDRQLIAALQINARESVAMLARQLGIARTTVTSRLARLESSKVITGYGV
RLGQRVVSGGLQAYVGITVQPRSGKEVVRRLSAMAQVQQLCAVSGEFDYVAWLRTDSPEQ
LDQLLDLIGSVEGVEKTTTSIILSSKIDRGQPV