Protein Info for Psyr_4564 in Pseudomonas syringae pv. syringae B728a ΔmexB

Annotation: Biotin--acetyl-CoA-carboxylase ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 335 PF08279: HTH_11" amino acids 14 to 70 (57 residues), 43.2 bits, see alignment E=4.3e-15 TIGR00121: biotin--[acetyl-CoA-carboxylase] ligase" amino acids 94 to 329 (236 residues), 192 bits, see alignment E=6.1e-61 PF03099: BPL_LplA_LipB" amino acids 99 to 222 (124 residues), 81.4 bits, see alignment E=8.6e-27 PF02237: BPL_C" amino acids 288 to 330 (43 residues), 23.4 bits, see alignment 6.6e-09

Best Hits

KEGG orthology group: K03524, BirA family transcriptional regulator, biotin operon repressor / biotin-[acetyl-CoA-carboxylase] ligase [EC: 6.3.4.15] (inferred from 100% identity to psb:Psyr_4564)

Predicted SEED Role

"Biotin operon repressor / Biotin-protein ligase (EC 6.3.4.15)" in subsystem Biotin biosynthesis (EC 6.3.4.15)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.4.15

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZMM8 at UniProt or InterPro

Protein Sequence (335 amino acids)

>Psyr_4564 Biotin--acetyl-CoA-carboxylase ligase (Pseudomonas syringae pv. syringae B728a ΔmexB)
MPLRGYDACLIARRFQMLTLLKLLADGAFHSGQVLGDALGISRSAVWKQLQQLEADLGID
VHKVRGRGYRLATPISLLSPADIMQSGFPAGWSVRTYDSIDSTNAEAARLIAQGVPMPLL
VVAEQQTSGRGRRGRKWISPFAENLYYSLVLRIDGGMRQLEGLSLLVGLAVMNVLRDMGV
QDAGLKWPNDVLVGRQKIAGILLELIGDPADVCHVIIGIGVNVNMRSSSEVDQLWTSVRL
ETGGLVDRNQVAARISTQLEALMAVHRKEGFAAFQKEWERGHVWQGAAVKLLSGVEVVEG
LVLGVDSLGALRLEVNGVEKSFSGGELSLRLRDDS