Protein Info for Psyr_4482 in Pseudomonas syringae pv. syringae B728a ΔmexB

Annotation: outer membrane transport energization protein ExbD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 134 transmembrane" amino acids 20 to 38 (19 residues), see Phobius details PF02472: ExbD" amino acids 12 to 132 (121 residues), 108.2 bits, see alignment E=1.6e-35

Best Hits

Swiss-Prot: 51% identical to EXBD_PSEAE: Biopolymer transport protein ExbD (exbD) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K03559, biopolymer transport protein ExbD (inferred from 100% identity to psb:Psyr_4482)

MetaCyc: 34% identical to Ton complex subunit ExbD (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Biopolymer transport protein ExbD/TolR" in subsystem Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZMW0 at UniProt or InterPro

Protein Sequence (134 amino acids)

>Psyr_4482 outer membrane transport energization protein ExbD (Pseudomonas syringae pv. syringae B728a ΔmexB)
MSFSTSNDDDAISDINITPLVDVMLVLLVTFIVTAPLLNNAIPLDLPQTVATTSLDQADP
VVVSVDASGGVFIDSEAVALEQLPEALQALHSKDPDVAVSLRADQATGYGRVAQVLADVQ
KAGISRLSVITESP