Protein Info for Psyr_4366 in Pseudomonas syringae pv. syringae B728a ΔmexB

Annotation: Protein of unknown function DUF163

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 155 PF02590: SPOUT_MTase" amino acids 1 to 154 (154 residues), 156.4 bits, see alignment E=3.1e-50 TIGR00246: rRNA large subunit m3Psi methyltransferase RlmH" amino acids 2 to 155 (154 residues), 201.3 bits, see alignment E=4.1e-64

Best Hits

Swiss-Prot: 100% identical to RLMH_PSESM: Ribosomal RNA large subunit methyltransferase H (rlmH) from Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)

KEGG orthology group: K00783, hypothetical protein (inferred from 99% identity to psp:PSPPH_4408)

MetaCyc: 57% identical to 23S rRNA m3psi1915 methyltransferase (Escherichia coli K-12 substr. MG1655)
RXN-11592 [EC: 2.1.1.177]

Predicted SEED Role

"LSU m3Psi1915 methyltransferase RlmH" in subsystem Ribosome biogenesis bacterial

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.177

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZN76 at UniProt or InterPro

Protein Sequence (155 amino acids)

>Psyr_4366 Protein of unknown function DUF163 (Pseudomonas syringae pv. syringae B728a ΔmexB)
MRLRLIAVGSRMPKWVEEGWHEYAKRMPSELALELVEIPLNTRGKNADVARFIRQEGEAM
LAKVQPGERIVTLEVQGKPWSTEQLAVELDRWRLDARTVNLMVGGPEGLAPEVCARSEQR
WSLSPLTLPHPLVRILIGEQMYRAWTVLSGHPYHK