Protein Info for Psyr_4347 in Pseudomonas syringae pv. syringae B728a ΔmexB

Annotation: Protein of unknown function UPF0054

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 166 PF02130: YbeY" amino acids 21 to 141 (121 residues), 124.9 bits, see alignment E=1e-40 TIGR00043: rRNA maturation RNase YbeY" amino acids 36 to 142 (107 residues), 120.2 bits, see alignment E=2.2e-39

Best Hits

Swiss-Prot: 100% identical to YBEY_PSEU2: Endoribonuclease YbeY (ybeY) from Pseudomonas syringae pv. syringae (strain B728a)

KEGG orthology group: K07042, probable rRNA maturation factor (inferred from 100% identity to psb:Psyr_4347)

Predicted SEED Role

"Metal-dependent hydrolase YbeY, involved in rRNA and/or ribosome maturation and assembly"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZN95 at UniProt or InterPro

Protein Sequence (166 amino acids)

>Psyr_4347 Protein of unknown function UPF0054 (Pseudomonas syringae pv. syringae B728a ΔmexB)
MLELDLQVASETSAPDEARLRLWCEMGLRQRSADSELTIRLVDETEGRELNNTWRHKNYA
TNVLSFPADVPDDMLDIPLLGDLVICVPVVNREAVEQGKSVDAHWAHMVIHGCLHLLGYD
HIDDEEAEEMEALERTLLEELGYPDPYADDESADPPHSDTPSKDHE