Protein Info for Psyr_4279 in Pseudomonas syringae pv. syringae B728a ΔmexB

Annotation: 16S rRNA m(2)G 1207 methyltransferase / 23S rRNA m(2)G-1835 methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF05175: MTS
  • amino acids 201 to 371 (171 residues), 174.7 bits, E=4.1e-55
• PF06325: PrmA
  • amino acids 231 to 306 (76 residues), 31.8 bits, E=3.3e-11
• PF13847: Methyltransf_31
  • amino acids 234 to 311 (78 residues), 43.6 bits, E=8.1e-15
• PF13649: Methyltransf_25
  • amino acids 235 to 311 (77 residues), 34.7 bits, E=7e-12
• PF08242: Methyltransf_12
  • amino acids 237 to 312 (76 residues), 30 bits, E=2.1e-10
• PF08241: Methyltransf_11
  • amino acids 237 to 314 (78 residues), 21.5 bits, E=8.9e-08

Best Hits

Swiss-Prot: 100% identical to RLMG_PSEU2: Ribosomal RNA large subunit methyltransferase G (rlmG) from Pseudomonas syringae pv. syringae (strain B728a)

KEGG orthology group: K00564, ribosomal RNA small subunit methyltransferase C [EC: 2.1.1.172] (inferred from 100% identity to psb:Psyr_4279)

Predicted SEED Role

"23S rRNA (guanine-N-2-) -methyltransferase rlmG (EC 2.1.1.-)" (EC 2.1.1.-)

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Anthocyanin biosynthesis
• Benzoxazinone biosynthesis
• Biosynthesis of alkaloids derived from shikimate pathway
• Carotenoid biosynthesis - General
• Flavonoid biosynthesis
• Histidine metabolism
• Insect hormone biosynthesis
• Naphthalene and anthracene degradation
• Phenylpropanoid biosynthesis
• Porphyrin and chlorophyll metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-, 2.1.1.172

Use Curated BLAST to search for 2.1.1.- or 2.1.1.172

Sequence Analysis Tools

See Q4ZNG3 at UniProt or InterPro

Protein Sequence (374 amino acids)

>Psyr_4279 16S rRNA m(2)G 1207 methyltransferase / 23S rRNA m(2)G-1835 methyltransferase (Pseudomonas syringae pv. syringae B728a ΔmexB)
MPLLISPFAELDLIRQPEQQDEPLQAFDAADEYLLNHVAQAGLSLPSRVLVLNDSFGALA
ASLAPHATVISSTDSFLAAQALEKNLARNGMSYDAVPHIPASEALQGPFDWVLIRVPKTL
ALLEEQLIRLQGQLAPGARVIAAAMVKHLPRSAGDLLEEYVGPVQASLAVKKARLLFATP
QPMEVRTSPYPTRYRLEEPAIELLNHANVFCRDGLDIGTRAFLPHLPKNLGTARVADLGC
GNGVLAIASALDNPQAHYTLVDESFMAVKSAAENWRATLGDRDVRVRAGDGLEMQEPDSL
DVVLCNPPFHQQQVVGDFLAWRMFLQARAALVTGGALYIVGNRHLGYHTKLSRLFRGVEQ
VAATPKFVILKARK