Protein Info for Psyr_4264 in Pseudomonas syringae pv. syringae B728a ΔmexB

Annotation: ABC transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 554 TIGR03719: ATP-binding cassette protein, ChvD family" amino acids 2 to 553 (552 residues), 977 bits, see alignment E=2.6e-298 PF00005: ABC_tran" amino acids 22 to 191 (170 residues), 92.8 bits, see alignment E=6.3e-30 amino acids 340 to 473 (134 residues), 78 bits, see alignment E=2.2e-25 PF12848: ABC_tran_Xtn" amino acids 230 to 305 (76 residues), 45.3 bits, see alignment E=1.5e-15

Best Hits

Swiss-Prot: 73% identical to ETTA_HAEIN: Energy-dependent translational throttle protein EttA (ettA) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_4264)

Predicted SEED Role

"Glutathione-regulated potassium-efflux system ATP-binding protein" in subsystem Glutathione-regulated potassium-efflux system and associated functions or Potassium homeostasis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZNH8 at UniProt or InterPro

Protein Sequence (554 amino acids)

>Psyr_4264 ABC transporter (Pseudomonas syringae pv. syringae B728a ΔmexB)
MAQYVYTMHRLSKVVPPKREILKNISLSFFPGAKIGVLGLNGSGKSTLLKIMAGVDTEFD
GEARPMPELNVGYLPQEPQLDPNKTVREVVEEAVSVIKDAQARLDQVYAEYAEPDADFDK
LAAEQAKLESILQASDGHNLERQLEVAADALRLPAWDAKVSVLSGGEKRRVALCRLLLSA
PDMLLLDEPTNHLDADSVAWLEHFLHDFPGTVVAITHDRYFLDNVAGWILELDRGAGIPY
EGNYSGWLEAKSDRLAQESKQQTAHEKAMKDELEWVRKGAKARQSKSKARLQRFEEMQSQ
EFQKRSETNEIYIPAGPRLGDKVIEFKNVTKGYGDRVLIDNLSFSMPKGAIVGVIGGNGA
GKSTLFRMLMGKEQPDSGSIEVGETVQLACVDQSRDDLDGSKSVFQAVSDGSDVIRIGNY
EIPSRTYVGRFNFKGGDQQKFVKDLSGGERGRLHLALTLKEGGNVLLLDEPSNDLDVETL
RSLEEALLDFPGAAIVISHDRWFLDRVATHILAYEDDSQAIFFEGNYTEYEADRKKRLGE
AAAQPHRVRHKKLA