Protein Info for Psyr_4221 in Pseudomonas syringae pv. syringae B728a ΔmexB

Annotation: diguanylate cyclase/phosphodiesterase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 607 PF01590: GAF" amino acids 29 to 159 (131 residues), 47.6 bits, see alignment E=3.7e-16 PF00990: GGDEF" amino acids 169 to 306 (138 residues), 33.9 bits, see alignment E=3.9e-12 PF00563: EAL" amino acids 341 to 574 (234 residues), 235.5 bits, see alignment E=8.4e-74

Best Hits

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_4221)

Predicted SEED Role

"GAF domain/GGDEF domain/EAL domain protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZNM1 at UniProt or InterPro

Protein Sequence (607 amino acids)

>Psyr_4221 diguanylate cyclase/phosphodiesterase (Pseudomonas syringae pv. syringae B728a ΔmexB)
MNASAPIPLNETQRLLRIRELCVLEDTSDDVFDELVAMTAAFFEAPIALISIVDEHRQFF
RARVGLKARETPRNVSFCAYTILSDTLFEIPDATLDARFVNNGLVTGHPDIRYYAGAPLI
TDDGIALGSLCVIDTKPREPMSEYQTQMLKRFASLVMKRIVGLRLSCFIDQPTGLYNRSR
LQEDIHQAVASSVDYQLVVVDMITSAFLNDIVKALGYSFSQDLVTAIKGRLECLLPPTCS
LYKVSPTRFGFLLAGDRTPEHLFRTILKDFETPVECRGIPVQMQVGLGVVTLNQGAVEEQ
DWMRMVISAADDARDRDLGWAMYEPHFDAAQQRAFKLLSSLTRAVYAHDQLRLVYQPRID
LDSGLCTSVEALLRWNHPTLGAIGPAEFVPLAEKTALMRPLSLWVLTSAIEQAARWQQQG
FDFRIAINVTPEDLTGPAFTDRMIRLLGMHKIDPTRFELEFTEGALMHNPAEVRHQLERM
RQMGMDVAIDDFGTGYSNWNYLRQLPATTVKLDQSLIRNLASDKTDQRLVKALIGLAKKL
GYCVVAEGIETDEIRCLVKQWGCDEGQGYLIAKPMEAEALLNWIGPNQRLQSAAQAAEAA
VVRDKRL