Protein Info for Psyr_4182 in Pseudomonas syringae pv. syringae B728a ΔmexB

Annotation: Protein of unknown function DUF150

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 158 PF02576: RimP_N" amino acids 17 to 89 (73 residues), 106.1 bits, see alignment E=9.9e-35 PF17384: DUF150_C" amino acids 92 to 157 (66 residues), 67.6 bits, see alignment E=9e-23

Best Hits

Swiss-Prot: 100% identical to RIMP_PSEU2: Ribosome maturation factor RimP (rimP) from Pseudomonas syringae pv. syringae (strain B728a)

KEGG orthology group: K09748, ribosome maturation factor RimP (inferred from 100% identity to psb:Psyr_4182)

Predicted SEED Role

"FIG000325: clustered with transcription termination protein NusA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P95578 at UniProt or InterPro

Protein Sequence (158 amino acids)

>Psyr_4182 Protein of unknown function DUF150 (Pseudomonas syringae pv. syringae B728a ΔmexB)
MHEGVQVSSKLEQLQDLLAPVVVALGYQCWGIDFSSQGKHSVLRIYIDKEGGVLVDDCAI
VSRQISGVLDVEDPISTEYTLEVSSPGMERPLFTIEQFASYAGEQVKIKLRSPFEGRRNF
QGLLRGVEEQDVVVQVEDHEFLLPIDMIDKANIIPTFD