Protein Info for Psyr_4104 in Pseudomonas syringae pv. syringae B728a ΔmexB

Annotation: UDP-N-acetylmuramoylalanine--D-glutamate ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF21799: MurD-like_N
  • amino acids 11 to 97 (87 residues), 94 bits, E=8.8e-31
• TIGR01087: UDP-N-acetylmuramoylalanine--D-glutamate ligase
  • amino acids 12 to 445 (434 residues), 404.5 bits, E=3.4e-125
• PF08245: Mur_ligase_M
  • amino acids 114 to 285 (172 residues), 84.9 bits, E=1.1e-27
• PF02875: Mur_ligase_C
  • amino acids 307 to 378 (72 residues), 36.7 bits, E=6.5e-13

Best Hits

Swiss-Prot: 100% identical to MURD_PSEU2: UDP-N-acetylmuramoylalanine--D-glutamate ligase (murD) from Pseudomonas syringae pv. syringae (strain B728a)

KEGG orthology group: K01925, UDP-N-acetylmuramoylalanine--D-glutamate ligase [EC: 6.3.2.9] (inferred from 100% identity to psb:Psyr_4104)

Predicted SEED Role

"UDP-N-acetylmuramoylalanine--D-glutamate ligase (EC 6.3.2.9)" in subsystem Peptidoglycan Biosynthesis (EC 6.3.2.9)

MetaCyc Pathways

• peptidoglycan biosynthesis I (meso-diaminopimelate containing) (12/12 steps found)
• UDP-N-acetylmuramoyl-pentapeptide biosynthesis I (meso-diaminopimelate containing) (8/8 steps found)
• UDP-N-acetylmuramoyl-pentapeptide biosynthesis II (lysine-containing) (7/8 steps found)
• peptidoglycan biosynthesis III (mycobacteria) (11/15 steps found)
• peptidoglycan biosynthesis II (staphylococci) (12/17 steps found)
• peptidoglycan biosynthesis IV (Enterococcus faecium) (12/17 steps found)
• peptidoglycan biosynthesis V (β-lactam resistance) (11/17 steps found)

KEGG Metabolic Maps

• D-Glutamine and D-glutamate metabolism
• Peptidoglycan biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.2.9

Sequence Analysis Tools

See Q4ZNY8 at UniProt or InterPro

Protein Sequence (448 amino acids)

>Psyr_4104 UDP-N-acetylmuramoylalanine--D-glutamate ligase (Pseudomonas syringae pv. syringae B728a ΔmexB)
MSLIVSDRFRIVVGLGKSGMSLVRFLANQGVSFAVADTRENPPELATLRRDYPQVEVRCG
ELDVDFLCRADELYVSPGLALATPALQQAHARGVKLSGDIELFARYAKAPVIAITGSNAK
STVTTLVGEMAAAAGKRVAVGGNLGTPALDLLSDEVELYVMELSSFQLETTDQLNAEVAT
VLNISEDHMDRYSGLPAYHLAKHRIFRGARQVVVNGQDALSRPLIGEGLPCWTFGLNKPD
FHGFGLREENGEKYLAFQFENLMPVRELKVRGAHNQANALAALALGHAVGLPFDAMLASL
REFTGLEHRCQWLREHDGVHYYNDSKATNVGAALAAIEGLGSDIDGKLVLIAGGDGKGAD
FSGLRAPVARHCRAAVLLGRDAELIAQALGDAVPLLRVDTVQAAVEHSAKLAQCGDAVLL
SPACASLDMFKNYEERGRVFAQAVECLS