Protein Info for Psyr_4069 in Pseudomonas syringae pv. syringae B728a ΔmexB

Annotation: ATP-binding region, ATPase-like:Histidine kinase, HAMP region:Histidine kinase A, N-terminal

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 429 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 131 to 155 (25 residues), see Phobius details PF00672: HAMP" amino acids 153 to 207 (55 residues), 28.4 bits, see alignment 2.5e-10 PF00512: HisKA" amino acids 213 to 275 (63 residues), 49.1 bits, see alignment E=7.4e-17 PF02518: HATPase_c" amino acids 326 to 425 (100 residues), 70.5 bits, see alignment E=2.5e-23

Best Hits

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_4069)

Predicted SEED Role

"two-component system sensor protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZP23 at UniProt or InterPro

Protein Sequence (429 amino acids)

>Psyr_4069 ATP-binding region, ATPase-like:Histidine kinase, HAMP region:Histidine kinase A, N-terminal (Pseudomonas syringae pv. syringae B728a ΔmexB)
MEFKQSLAQRIIIAFALMSALVAGSFAIGIISTVHLVEEKLISAGLGGDLNRLMLMDSVS
DWSHRPKPDQLFYFSNGPGDFDLPKDIRHLEPGFHEVFRGPLSYHAMIEVVDGRHYALLQ
DQSDFEERERVLFAVVLVGFVLALALAVFLGWVLARRVMAPVVRLARQVRHRDQLLGLAP
PLAPDYAADEVGELAVAFDATLGRLRQALIRERMFTSDVSHELRTPLMVLASSCELLLEN
PALDLRGRRQVERIGRACEEMRDLVQTFLMLARTQREDPAMTPKATLVGVAEQLISQWRD
PIESKGLQLTYTPPADDQLSDIRYNATFLHAVMGNLLRNALHYTDHGFIALTLHAESFTV
EDSGVGIPEEKREAMFEPFVRGNEQRGEGLGLGLSLVQRICTNQGWSVDLTPMEPHGCRF
KVTLNVIKP