Protein Info for Psyr_4060 in Pseudomonas syringae pv. syringae B728a ΔmexB

Annotation: diguanylate cyclase/phosphodiesterase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 705 transmembrane" amino acids 35 to 57 (23 residues), see Phobius details amino acids 176 to 204 (29 residues), see Phobius details TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 268 to 431 (164 residues), 99.1 bits, see alignment E=1.1e-32 PF00990: GGDEF" amino acids 272 to 429 (158 residues), 121.8 bits, see alignment E=2.5e-39 PF00563: EAL" amino acids 449 to 684 (236 residues), 253.2 bits, see alignment E=2.2e-79

Best Hits

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_4060)

Predicted SEED Role

"GGDEF domain/EAL domain protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZP32 at UniProt or InterPro

Protein Sequence (705 amino acids)

>Psyr_4060 diguanylate cyclase/phosphodiesterase (Pseudomonas syringae pv. syringae B728a ΔmexB)
MRAWFFEGHEAICPPTRTKERPLKLELKNSLSVKLLRVVLLSALLVGVLLSCAQIIFDAY
KTRQAVASDAERILGMFRDPSTQAVYSLDREMGMQVIEGLFQDDSVRMASIGHPNESLLA
EKDRPLKDSPTRWLTDLILGQERSFTTQLVGRSPYSEYYGDLRITLDTANYGESFLVNAG
IIFVAGVLRALAMGLVLYLVYHWLLTKPLSKIIEHLIAINPDRPSEHQLPLLKGHEKNEL
GIWVNTANQLLASIERHTYLRHEAENNLQRMAQYDFLTGLPNRLQLQTGLDRILEDAGRQ
QHRVAVLCVGLDDFKGINEQFSYQSGDQLLLALADRLRAHSVLLGALARLGGDQFALVQS
NIEQPYEAAELAQNILDELEAPFIVGDQQIRLRATIGITLFPEDGDSTEKLLQKAEQTMT
LAKARSRNRYQFYIASVDSEMRRRRELEKDLREALPRNQLYLVYQPQISYRDHRIVGVEA
LIRWQHPEHGLVPPDVFIPLAEQNGTIIVIGEWVLDQACRQLREWLDQGFTDLRMAVNLS
TVQLHHAELPRVVNNLLQIYRLPLRSLELEVTETGLMEDINTAAQHLLSLRRSGALIAID
DFGTGYSSLSYLKSLPLDKIKIDRSFVQDLIDDDDDATIVRAIIQLGKSLGMQVIAEGVE
TVEQEAYVVTEGCHEGQGYLYSKPLPGRELLAYLKQSRQDHAASL