Protein Info for Psyr_4020 in Pseudomonas syringae pv. syringae B728a ΔmexB

Annotation: Exodeoxyribonuclease I subunit C

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 476 PF00929: RNase_T" amino acids 7 to 186 (180 residues), 85.3 bits, see alignment E=7.5e-28 PF08411: Exonuc_X-T_C" amino acids 205 to 468 (264 residues), 325.3 bits, see alignment E=2.6e-101

Best Hits

KEGG orthology group: K01141, exodeoxyribonuclease I [EC: 3.1.11.1] (inferred from 100% identity to psb:Psyr_4020)

Predicted SEED Role

"Exodeoxyribonuclease I (EC 3.1.11.1)" in subsystem DNA Repair Base Excision (EC 3.1.11.1)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.11.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZP72 at UniProt or InterPro

Protein Sequence (476 amino acids)

>Psyr_4020 Exodeoxyribonuclease I subunit C (Pseudomonas syringae pv. syringae B728a ΔmexB)
MTSSIFWYDYETTGINPRNDRALQMAGIRTDTELNEIAPPVNLHCQLSDDILPHPAACMI
TGITPATLAEKGLCEADFMTRVHAELSAPGTCGAGYNTLRFDDEVTRYSFYRNFFDPYAR
EWQGGNSRWDLIDVVRAAYALRPDGIVWPEQDGRVTLKLERLTAANGIDHGQAHDALSDV
RATIALARLIREKQPKLYDYLFALRSKQKVQEQVRLMQPLVHISGRFSAARNYLGVVLPL
AWHPHNRNALIVCDLHLDHAPLLHEDAEILKRRLYTRHDALSDGELPVPLKLLHINRCPV
IAPLGVLRSEDQQRLQLDMAGYQARATQLSENREVWHGKLAAIYGKDDFAASEDPEQQLY
DGFIGDRDRRLCEQVRQAEPEQLARDAWPFDDARLPELLFRYRARNFPDTLSGEEQTRWR
DFCQQRLRNPEWGAPNTLHDFTAAWVECSLSAGPEQLEVLRQWQDYAHRLSNRLGV